Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKY10_RS16845 Genome accession   NZ_CP150253
Coordinates   3201583..3201723 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL P4-0290     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3196583..3206723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY10_RS16820 (MKY10_16820) - 3196860..3197240 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  MKY10_RS16825 (MKY10_16825) comA 3197259..3197903 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKY10_RS16830 (MKY10_16830) comP 3197984..3200296 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  MKY10_RS16835 (MKY10_16835) comX 3200312..3200533 (-) 222 WP_014480704.1 competence pheromone ComX -
  MKY10_RS16840 (MKY10_16840) - 3200535..3201398 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  MKY10_RS16845 (MKY10_16845) degQ 3201583..3201723 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKY10_RS16850 (MKY10_16850) - 3201945..3202070 (+) 126 WP_003228793.1 hypothetical protein -
  MKY10_RS16855 (MKY10_16855) - 3202185..3202553 (+) 369 WP_046381300.1 hypothetical protein -
  MKY10_RS16860 (MKY10_16860) pdeH 3202529..3203758 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  MKY10_RS16865 (MKY10_16865) - 3203895..3205367 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MKY10_RS16870 (MKY10_16870) - 3205383..3205934 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MKY10_RS16875 (MKY10_16875) - 3206031..3206429 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=967984 MKY10_RS16845 WP_003220708.1 3201583..3201723(-) (degQ) [Bacillus sp. FSL P4-0290]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=967984 MKY10_RS16845 WP_003220708.1 3201583..3201723(-) (degQ) [Bacillus sp. FSL P4-0290]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment