Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | MKY10_RS08845 | Genome accession | NZ_CP150253 |
| Coordinates | 1664263..1664673 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus sp. FSL P4-0290 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1615303..1669307 | 1664263..1664673 | within | 0 |
Gene organization within MGE regions
Location: 1615303..1669307
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKY10_RS08495 (MKY10_08495) | - | 1615303..1615695 (-) | 393 | Protein_1612 | sigma-70 family RNA polymerase sigma factor | - |
| MKY10_RS08500 (MKY10_08500) | - | 1615701..1616219 (-) | 519 | WP_015714342.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MKY10_RS08505 (MKY10_08505) | - | 1616488..1617024 (+) | 537 | WP_309520477.1 | AAA family ATPase | - |
| MKY10_RS08510 (MKY10_08510) | - | 1617380..1617547 (+) | 168 | WP_003229900.1 | hypothetical protein | - |
| MKY10_RS08515 (MKY10_08515) | sknR | 1617814..1618164 (-) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
| MKY10_RS08520 (MKY10_08520) | - | 1618341..1618571 (+) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| MKY10_RS08525 (MKY10_08525) | - | 1618601..1618741 (+) | 141 | WP_003229902.1 | hypothetical protein | - |
| MKY10_RS08530 (MKY10_08530) | - | 1618815..1619384 (+) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| MKY10_RS08535 (MKY10_08535) | - | 1619381..1619638 (+) | 258 | WP_003245994.1 | YqaH family protein | - |
| MKY10_RS08540 (MKY10_08540) | - | 1619635..1619808 (+) | 174 | WP_119123069.1 | hypothetical protein | - |
| MKY10_RS08545 (MKY10_08545) | - | 1619768..1619962 (+) | 195 | WP_003229905.1 | hypothetical protein | - |
| MKY10_RS08550 (MKY10_08550) | - | 1620068..1621027 (+) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| MKY10_RS08555 (MKY10_08555) | - | 1621030..1621884 (+) | 855 | WP_003229907.1 | recombinase RecT | - |
| MKY10_RS08560 (MKY10_08560) | - | 1621960..1622637 (+) | 678 | WP_116362964.1 | DnaD domain protein | - |
| MKY10_RS08565 (MKY10_08565) | - | 1622519..1623460 (+) | 942 | WP_075058863.1 | ATP-binding protein | - |
| MKY10_RS08570 (MKY10_08570) | - | 1623451..1623600 (+) | 150 | WP_003229910.1 | hypothetical protein | - |
| MKY10_RS08575 (MKY10_08575) | - | 1623696..1624124 (+) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MKY10_RS08580 (MKY10_08580) | - | 1624206..1624412 (+) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| MKY10_RS08585 (MKY10_08585) | - | 1624486..1625415 (-) | 930 | WP_003229913.1 | hypothetical protein | - |
| MKY10_RS08590 (MKY10_08590) | - | 1625613..1626068 (+) | 456 | WP_004398775.1 | hypothetical protein | - |
| MKY10_RS08595 (MKY10_08595) | - | 1626212..1626676 (+) | 465 | WP_004398685.1 | hypothetical protein | - |
| MKY10_RS08600 (MKY10_08600) | terS | 1626744..1627463 (+) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| MKY10_RS08605 (MKY10_08605) | - | 1627456..1628751 (+) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| MKY10_RS08610 (MKY10_08610) | - | 1628755..1630287 (+) | 1533 | WP_004398894.1 | phage portal protein | - |
| MKY10_RS08615 (MKY10_08615) | - | 1630284..1631201 (+) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| MKY10_RS08620 (MKY10_08620) | - | 1631242..1631895 (+) | 654 | WP_003229920.1 | hypothetical protein | - |
| MKY10_RS08625 (MKY10_08625) | - | 1631928..1632896 (+) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| MKY10_RS08630 (MKY10_08630) | - | 1632915..1633850 (+) | 936 | WP_003229922.1 | phage major capsid protein | - |
| MKY10_RS08635 (MKY10_08635) | - | 1633861..1634172 (+) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| MKY10_RS08640 (MKY10_08640) | - | 1634176..1634571 (+) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| MKY10_RS08645 (MKY10_08645) | - | 1634568..1634930 (+) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| MKY10_RS08650 (MKY10_08650) | - | 1634927..1635430 (+) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| MKY10_RS08655 (MKY10_08655) | - | 1635443..1635880 (+) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| MKY10_RS08660 (MKY10_08660) | - | 1635877..1636068 (+) | 192 | WP_010886574.1 | hypothetical protein | - |
| MKY10_RS08665 (MKY10_08665) | - | 1636069..1637469 (+) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| MKY10_RS08670 (MKY10_08670) | - | 1637472..1637915 (+) | 444 | WP_003229930.1 | phage tail tube protein | - |
| MKY10_RS08675 (MKY10_08675) | bsrH | 1638169..1638258 (-) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| MKY10_RS08680 (MKY10_08680) | txpA | 1638638..1638817 (-) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| MKY10_RS08685 (MKY10_08685) | - | 1638963..1639412 (+) | 450 | WP_032722171.1 | phage portal protein | - |
| MKY10_RS08690 (MKY10_08690) | - | 1639454..1639591 (+) | 138 | WP_021480099.1 | hypothetical protein | - |
| MKY10_RS08695 (MKY10_08695) | - | 1639594..1644351 (+) | 4758 | WP_339226395.1 | phage tail tape measure protein | - |
| MKY10_RS08700 (MKY10_08700) | - | 1644344..1645003 (+) | 660 | WP_032722169.1 | LysM peptidoglycan-binding domain-containing protein | - |
| MKY10_RS08705 (MKY10_08705) | - | 1645016..1645996 (+) | 981 | WP_032722168.1 | hypothetical protein | - |
| MKY10_RS08710 (MKY10_08710) | - | 1645993..1646259 (+) | 267 | WP_032722167.1 | DUF2577 family protein | - |
| MKY10_RS08715 (MKY10_08715) | - | 1646272..1646697 (+) | 426 | WP_032722166.1 | DUF2634 domain-containing protein | - |
| MKY10_RS08720 (MKY10_08720) | - | 1646690..1647736 (+) | 1047 | WP_032722165.1 | baseplate J/gp47 family protein | - |
| MKY10_RS08725 (MKY10_08725) | - | 1647720..1648298 (+) | 579 | WP_032722164.1 | YmfQ family protein | - |
| MKY10_RS08730 (MKY10_08730) | - | 1648295..1648567 (+) | 273 | WP_032722163.1 | hypothetical protein | - |
| MKY10_RS08735 (MKY10_08735) | - | 1648571..1649671 (+) | 1101 | WP_032722161.1 | pyocin knob domain-containing protein | - |
| MKY10_RS08740 (MKY10_08740) | - | 1649681..1650016 (+) | 336 | WP_009967793.1 | XkdW family protein | - |
| MKY10_RS08745 (MKY10_08745) | - | 1650013..1650177 (+) | 165 | WP_003229944.1 | XkdX family protein | - |
| MKY10_RS08750 (MKY10_08750) | - | 1650265..1651158 (+) | 894 | WP_032722160.1 | hypothetical protein | - |
| MKY10_RS08755 (MKY10_08755) | - | 1651204..1651626 (+) | 423 | WP_017697460.1 | holin family protein | - |
| MKY10_RS08760 (MKY10_08760) | cwlA | 1651671..1652489 (+) | 819 | WP_017697459.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| MKY10_RS08765 (MKY10_08765) | - | 1652654..1653133 (+) | 480 | WP_004399085.1 | hypothetical protein | - |
| MKY10_RS08770 (MKY10_08770) | - | 1653149..1653511 (+) | 363 | WP_003229947.1 | hypothetical protein | - |
| MKY10_RS08775 (MKY10_08775) | - | 1653508..1653654 (-) | 147 | WP_009967791.1 | hypothetical protein | - |
| MKY10_RS08780 (MKY10_08780) | yqcF | 1653772..1654350 (-) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| MKY10_RS08785 (MKY10_08785) | yqcG | 1654365..1655960 (-) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| MKY10_RS08790 (MKY10_08790) | - | 1656330..1656488 (-) | 159 | WP_003245945.1 | hypothetical protein | - |
| MKY10_RS08795 (MKY10_08795) | phrE | 1656598..1656732 (-) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| MKY10_RS08800 (MKY10_08800) | rapE | 1656722..1657849 (-) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| MKY10_RS08805 (MKY10_08805) | - | 1658292..1659056 (+) | 765 | WP_017696291.1 | YqcI/YcgG family protein | - |
| MKY10_RS08810 (MKY10_08810) | arsR | 1659428..1659745 (+) | 318 | WP_029318103.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| MKY10_RS08815 (MKY10_08815) | - | 1659804..1660244 (+) | 441 | WP_032722151.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| MKY10_RS08820 (MKY10_08820) | acr3 | 1660267..1661307 (+) | 1041 | WP_032722149.1 | arsenite efflux transporter Acr3 | - |
| MKY10_RS08825 (MKY10_08825) | - | 1661319..1661738 (+) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| MKY10_RS08830 (MKY10_08830) | - | 1662093..1662271 (+) | 179 | Protein_1679 | hypothetical protein | - |
| MKY10_RS08835 (MKY10_08835) | spoIVCA | 1662229..1663689 (+) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| MKY10_RS08840 (MKY10_08840) | - | 1663720..1664067 (-) | 348 | Protein_1681 | sigma-70 family RNA polymerase sigma factor | - |
| MKY10_RS08845 (MKY10_08845) | nucA/comI | 1664263..1664673 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| MKY10_RS08850 (MKY10_08850) | - | 1664706..1665428 (-) | 723 | WP_010886572.1 | hypothetical protein | - |
| MKY10_RS08855 (MKY10_08855) | gnd | 1665680..1666573 (+) | 894 | WP_015251670.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| MKY10_RS08860 (MKY10_08860) | - | 1666592..1667218 (-) | 627 | WP_015251671.1 | TVP38/TMEM64 family protein | - |
| MKY10_RS08865 (MKY10_08865) | cwlH | 1667405..1668157 (+) | 753 | WP_015251672.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| MKY10_RS08870 (MKY10_08870) | - | 1668409..1669140 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=967954 MKY10_RS08845 WP_009967785.1 1664263..1664673(+) (nucA/comI) [Bacillus sp. FSL P4-0290]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=967954 MKY10_RS08845 WP_009967785.1 1664263..1664673(+) (nucA/comI) [Bacillus sp. FSL P4-0290]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |