Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   MKX44_RS19075 Genome accession   NZ_CP150246
Coordinates   3614697..3614981 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus sp. FSL M8-0359     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3571192..3619852 3614697..3614981 within 0


Gene organization within MGE regions


Location: 3571192..3619852
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX44_RS18760 (MKX44_18760) - 3571192..3571767 (+) 576 WP_185855208.1 hypothetical protein -
  MKX44_RS18765 (MKX44_18765) - 3571869..3572237 (+) 369 WP_185855209.1 YolD-like family protein -
  MKX44_RS18770 (MKX44_18770) - 3572262..3572492 (-) 231 WP_080626998.1 helix-turn-helix domain-containing protein -
  MKX44_RS18775 (MKX44_18775) - 3572747..3572890 (-) 144 WP_021837703.1 hypothetical protein -
  MKX44_RS18780 (MKX44_18780) - 3573086..3574585 (+) 1500 WP_185855210.1 T7SS effector LXG polymorphic toxin -
  MKX44_RS18785 (MKX44_18785) - 3574600..3574998 (+) 399 WP_185855211.1 Imm50 family immunity protein -
  MKX44_RS18790 (MKX44_18790) - 3575127..3575273 (-) 147 WP_185855212.1 hypothetical protein -
  MKX44_RS18795 (MKX44_18795) - 3575281..3575535 (-) 255 Protein_3654 peptidoglycan-binding domain-containing protein -
  MKX44_RS18800 (MKX44_18800) - 3575647..3576360 (-) 714 Protein_3655 N-acetylmuramoyl-L-alanine amidase -
  MKX44_RS18805 (MKX44_18805) - 3576412..3576675 (-) 264 WP_185855214.1 phage holin -
  MKX44_RS18810 (MKX44_18810) - 3576689..3576958 (-) 270 WP_185855215.1 hemolysin XhlA family protein -
  MKX44_RS18815 (MKX44_18815) - 3577021..3577206 (-) 186 WP_185855216.1 XkdX family protein -
  MKX44_RS18820 (MKX44_18820) - 3577203..3577526 (-) 324 WP_044789345.1 hypothetical protein -
  MKX44_RS18825 (MKX44_18825) - 3577539..3578876 (-) 1338 WP_003185328.1 BppU family phage baseplate upper protein -
  MKX44_RS18830 (MKX44_18830) - 3578897..3580942 (-) 2046 WP_139308922.1 hypothetical protein -
  MKX44_RS18835 (MKX44_18835) - 3580979..3582688 (-) 1710 WP_069500674.1 phage tail spike protein -
  MKX44_RS18840 (MKX44_18840) - 3582701..3583537 (-) 837 WP_009330398.1 phage tail family protein -
  MKX44_RS18845 (MKX44_18845) - 3583537..3587427 (-) 3891 WP_025807965.1 phage tail tape measure protein -
  MKX44_RS18850 (MKX44_18850) - 3587440..3587601 (-) 162 WP_009329201.1 hypothetical protein -
  MKX44_RS18855 (MKX44_18855) - 3587625..3587960 (-) 336 WP_009329202.1 hypothetical protein -
  MKX44_RS18860 (MKX44_18860) - 3588021..3588629 (-) 609 WP_009329203.1 major tail protein -
  MKX44_RS18865 (MKX44_18865) - 3588629..3589009 (-) 381 WP_009329204.1 DUF3168 domain-containing protein -
  MKX44_RS18870 (MKX44_18870) - 3589006..3589389 (-) 384 WP_009329205.1 HK97-gp10 family putative phage morphogenesis protein -
  MKX44_RS18875 (MKX44_18875) - 3589382..3589756 (-) 375 WP_009329206.1 phage head closure protein -
  MKX44_RS18880 (MKX44_18880) - 3589686..3590036 (-) 351 WP_009329207.1 head-tail connector protein -
  MKX44_RS18885 (MKX44_18885) - 3590052..3590501 (-) 450 WP_009329208.1 collagen-like protein -
  MKX44_RS18890 (MKX44_18890) - 3590527..3591843 (-) 1317 WP_017475036.1 phage major capsid protein -
  MKX44_RS18895 (MKX44_18895) - 3591884..3592513 (-) 630 WP_025807960.1 HK97 family phage prohead protease -
  MKX44_RS18900 (MKX44_18900) - 3592503..3593747 (-) 1245 WP_009330392.1 phage portal protein -
  MKX44_RS18905 (MKX44_18905) - 3593753..3593923 (-) 171 WP_009330391.1 hypothetical protein -
  MKX44_RS18910 (MKX44_18910) - 3593935..3595644 (-) 1710 WP_009330378.1 terminase TerL endonuclease subunit -
  MKX44_RS18915 (MKX44_18915) - 3595644..3596177 (-) 534 WP_009330377.1 phage terminase small subunit P27 family -
  MKX44_RS18920 (MKX44_18920) - 3596264..3596599 (-) 336 WP_339225316.1 transglycosylase -
  MKX44_RS18925 (MKX44_18925) - 3596559..3596933 (-) 375 WP_185855217.1 HNH endonuclease signature motif containing protein -
  MKX44_RS18930 (MKX44_18930) - 3597286..3597864 (-) 579 WP_185855218.1 hypothetical protein -
  MKX44_RS18935 (MKX44_18935) - 3598011..3599216 (-) 1206 WP_185855219.1 DUF3800 domain-containing protein -
  MKX44_RS18940 (MKX44_18940) - 3599451..3599993 (-) 543 WP_185855220.1 site-specific integrase -
  MKX44_RS18945 (MKX44_18945) - 3599993..3600433 (-) 441 WP_185855221.1 ArpU family phage packaging/lysis transcriptional regulator -
  MKX44_RS18950 (MKX44_18950) - 3600451..3600579 (-) 129 WP_260627244.1 hypothetical protein -
  MKX44_RS18955 (MKX44_18955) - 3600721..3600990 (-) 270 WP_339225323.1 hypothetical protein -
  MKX44_RS18960 (MKX44_18960) - 3601008..3601142 (-) 135 WP_256700694.1 hypothetical protein -
  MKX44_RS18965 (MKX44_18965) - 3601172..3601447 (-) 276 WP_065643955.1 hypothetical protein -
  MKX44_RS18970 (MKX44_18970) - 3601471..3602280 (-) 810 WP_185855222.1 DNA adenine methylase -
  MKX44_RS18975 (MKX44_18975) - 3602262..3603275 (-) 1014 WP_185855223.1 DNA cytosine methyltransferase -
  MKX44_RS18980 (MKX44_18980) - 3603280..3603531 (-) 252 WP_065643952.1 hypothetical protein -
  MKX44_RS18985 (MKX44_18985) - 3603528..3604070 (-) 543 WP_185855224.1 hypothetical protein -
  MKX44_RS18990 (MKX44_18990) - 3604106..3604306 (-) 201 WP_065643950.1 XtrA/YqaO family protein -
  MKX44_RS18995 (MKX44_18995) - 3604379..3604528 (-) 150 WP_142237344.1 BH0509 family protein -
  MKX44_RS19000 (MKX44_19000) - 3604633..3605181 (-) 549 WP_185855225.1 hypothetical protein -
  MKX44_RS19005 (MKX44_19005) - 3605333..3605491 (-) 159 WP_155266209.1 hypothetical protein -
  MKX44_RS19010 (MKX44_19010) - 3605481..3606329 (-) 849 WP_185855226.1 ATP-binding protein -
  MKX44_RS19015 (MKX44_19015) - 3606289..3607122 (-) 834 WP_185855227.1 phage replisome organizer N-terminal domain-containing protein -
  MKX44_RS19020 (MKX44_19020) - 3607115..3607333 (-) 219 WP_185855228.1 hypothetical protein -
  MKX44_RS19025 (MKX44_19025) - 3607368..3607568 (-) 201 WP_185855229.1 helix-turn-helix transcriptional regulator -
  MKX44_RS19030 (MKX44_19030) - 3607609..3607800 (-) 192 WP_185855230.1 helix-turn-helix transcriptional regulator -
  MKX44_RS19035 (MKX44_19035) - 3607963..3608379 (+) 417 WP_221899250.1 helix-turn-helix transcriptional regulator -
  MKX44_RS19040 (MKX44_19040) - 3608401..3608844 (+) 444 WP_185855232.1 ImmA/IrrE family metallo-endopeptidase -
  MKX44_RS19045 (MKX44_19045) - 3608897..3609961 (+) 1065 WP_185855233.1 site-specific integrase -
  MKX44_RS19055 (MKX44_19055) smpB 3610507..3610980 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  MKX44_RS19060 (MKX44_19060) rnr 3611092..3613395 (-) 2304 WP_003185414.1 ribonuclease R -
  MKX44_RS19065 (MKX44_19065) - 3613409..3614155 (-) 747 WP_003185416.1 carboxylesterase -
  MKX44_RS19070 (MKX44_19070) secG 3614296..3614526 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  MKX44_RS19075 (MKX44_19075) abrB 3614697..3614981 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  MKX44_RS19080 (MKX44_19080) - 3615010..3615243 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  MKX44_RS19085 (MKX44_19085) - 3615396..3615797 (+) 402 WP_026080846.1 transcriptional regulator -
  MKX44_RS19090 (MKX44_19090) - 3615967..3616365 (+) 399 WP_009329610.1 helix-turn-helix transcriptional regulator -
  MKX44_RS19095 (MKX44_19095) - 3616413..3617090 (-) 678 WP_003185432.1 ABC transporter permease -
  MKX44_RS19100 (MKX44_19100) opuCC 3617107..3618024 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  MKX44_RS19105 (MKX44_19105) - 3618038..3618691 (-) 654 WP_009329612.1 ABC transporter permease -
  MKX44_RS19110 (MKX44_19110) - 3618713..3619852 (-) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=967531 MKX44_RS19075 WP_003185421.1 3614697..3614981(-) (abrB) [Bacillus sp. FSL M8-0359]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=967531 MKX44_RS19075 WP_003185421.1 3614697..3614981(-) (abrB) [Bacillus sp. FSL M8-0359]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543

Multiple sequence alignment