Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACJX3V_RS01935 Genome accession   NZ_CP176523
Coordinates   380287..380406 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain MEPW12     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375287..385406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJX3V_RS01920 - 376899..377582 (+) 684 WP_003156341.1 response regulator transcription factor -
  ACJX3V_RS01925 - 377569..379002 (+) 1434 WP_161625271.1 sensor histidine kinase -
  ACJX3V_RS01930 rapC 379155..380303 (+) 1149 WP_409461557.1 tetratricopeptide repeat protein Regulator
  ACJX3V_RS01935 phrC 380287..380406 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACJX3V_RS01940 - 380557..380667 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACJX3V_RS01945 - 380747..382111 (-) 1365 WP_060657805.1 aspartate kinase -
  ACJX3V_RS01950 ceuB 382526..383479 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  ACJX3V_RS01955 - 383469..384416 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  ACJX3V_RS01960 - 384410..385168 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=967339 ACJX3V_RS01935 WP_003156334.1 380287..380406(+) (phrC) [Bacillus amyloliquefaciens strain MEPW12]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=967339 ACJX3V_RS01935 WP_003156334.1 380287..380406(+) (phrC) [Bacillus amyloliquefaciens strain MEPW12]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718