Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | MKY62_RS18105 | Genome accession | NZ_CP150217 |
| Coordinates | 3460773..3461057 (-) | Length | 94 a.a. |
| NCBI ID | WP_003185421.1 | Uniprot ID | A0A1Y0XQV9 |
| Organism | Bacillus sp. FSL R7-0646 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3414646..3465931 | 3460773..3461057 | within | 0 |
Gene organization within MGE regions
Location: 3414646..3465931
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKY62_RS17800 (MKY62_17800) | - | 3414646..3415236 (+) | 591 | WP_003185308.1 | hypothetical protein | - |
| MKY62_RS17805 (MKY62_17805) | - | 3415338..3415712 (+) | 375 | Protein_3456 | YolD-like family protein | - |
| MKY62_RS17810 (MKY62_17810) | - | 3416120..3416830 (-) | 711 | WP_003185310.1 | DUF421 domain-containing protein | - |
| MKY62_RS17815 (MKY62_17815) | - | 3417038..3417889 (+) | 852 | WP_035334177.1 | ferritin family protein | - |
| MKY62_RS17820 (MKY62_17820) | - | 3418045..3418638 (+) | 594 | WP_003185315.1 | cupin domain-containing protein | - |
| MKY62_RS17825 (MKY62_17825) | - | 3418759..3419712 (-) | 954 | WP_003185317.1 | glycoside hydrolase family 25 protein | - |
| MKY62_RS17830 (MKY62_17830) | - | 3419760..3420023 (-) | 264 | WP_011197884.1 | phage holin | - |
| MKY62_RS17835 (MKY62_17835) | - | 3420039..3420308 (-) | 270 | WP_009329192.1 | hemolysin XhlA family protein | - |
| MKY62_RS17840 (MKY62_17840) | - | 3420371..3420553 (-) | 183 | WP_011198303.1 | XkdX family protein | - |
| MKY62_RS17845 (MKY62_17845) | - | 3420550..3420864 (-) | 315 | WP_016886558.1 | hypothetical protein | - |
| MKY62_RS17850 (MKY62_17850) | - | 3420876..3422246 (-) | 1371 | WP_016886557.1 | phage baseplate upper protein | - |
| MKY62_RS17855 (MKY62_17855) | - | 3422267..3424222 (-) | 1956 | WP_016886556.1 | right-handed parallel beta-helix repeat-containing protein | - |
| MKY62_RS17860 (MKY62_17860) | - | 3424258..3425970 (-) | 1713 | WP_016886555.1 | phage tail protein | - |
| MKY62_RS17865 (MKY62_17865) | - | 3425983..3426819 (-) | 837 | WP_016886554.1 | phage tail family protein | - |
| MKY62_RS17870 (MKY62_17870) | - | 3426819..3431288 (-) | 4470 | WP_016886553.1 | phage tail tape measure protein | - |
| MKY62_RS17875 (MKY62_17875) | - | 3431497..3431859 (-) | 363 | WP_003185339.1 | hypothetical protein | - |
| MKY62_RS17880 (MKY62_17880) | - | 3431912..3432529 (-) | 618 | WP_016886552.1 | major tail protein | - |
| MKY62_RS17885 (MKY62_17885) | - | 3432544..3432927 (-) | 384 | WP_003185344.1 | hypothetical protein | - |
| MKY62_RS17890 (MKY62_17890) | - | 3432924..3433322 (-) | 399 | WP_016886551.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MKY62_RS17895 (MKY62_17895) | - | 3433322..3433630 (-) | 309 | WP_016886550.1 | phage head closure protein | - |
| MKY62_RS17900 (MKY62_17900) | - | 3433620..3433922 (-) | 303 | WP_016886549.1 | head-tail connector protein | - |
| MKY62_RS17905 (MKY62_17905) | - | 3433933..3434370 (-) | 438 | WP_029326520.1 | collagen-like protein | - |
| MKY62_RS17910 (MKY62_17910) | - | 3434395..3435678 (-) | 1284 | WP_025805204.1 | phage major capsid protein | - |
| MKY62_RS17915 (MKY62_17915) | - | 3435748..3436479 (-) | 732 | WP_016886547.1 | head maturation protease, ClpP-related | - |
| MKY62_RS17920 (MKY62_17920) | - | 3436424..3437734 (-) | 1311 | WP_016886546.1 | phage portal protein | - |
| MKY62_RS17925 (MKY62_17925) | - | 3437735..3437926 (-) | 192 | WP_035316082.1 | DUF1056 family protein | - |
| MKY62_RS17930 (MKY62_17930) | - | 3437939..3439648 (-) | 1710 | WP_016886544.1 | terminase TerL endonuclease subunit | - |
| MKY62_RS17935 (MKY62_17935) | - | 3439645..3440160 (-) | 516 | WP_011198313.1 | phage terminase small subunit P27 family | - |
| MKY62_RS17940 (MKY62_17940) | - | 3440391..3440765 (-) | 375 | WP_011198314.1 | HNH endonuclease | - |
| MKY62_RS17945 (MKY62_17945) | - | 3440792..3441100 (-) | 309 | WP_016886543.1 | hypothetical protein | - |
| MKY62_RS17950 (MKY62_17950) | cotD | 3441317..3441541 (-) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| MKY62_RS17955 (MKY62_17955) | - | 3442280..3442660 (-) | 381 | WP_009329244.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MKY62_RS17960 (MKY62_17960) | - | 3442787..3443059 (-) | 273 | WP_011198316.1 | DUF5052 family protein | - |
| MKY62_RS17965 (MKY62_17965) | - | 3443129..3443557 (-) | 429 | WP_011201737.1 | putative metallopeptidase | - |
| MKY62_RS17970 (MKY62_17970) | - | 3443520..3443642 (-) | 123 | WP_257227968.1 | hypothetical protein | - |
| MKY62_RS17975 (MKY62_17975) | - | 3443645..3443815 (-) | 171 | WP_009329251.1 | Fur-regulated basic protein FbpA | - |
| MKY62_RS17980 (MKY62_17980) | - | 3443812..3444351 (-) | 540 | WP_009329253.1 | ERCC4 domain-containing protein | - |
| MKY62_RS17985 (MKY62_17985) | - | 3444348..3444785 (-) | 438 | WP_011198317.1 | hypothetical protein | - |
| MKY62_RS17990 (MKY62_17990) | - | 3444763..3445026 (-) | 264 | WP_016886542.1 | hypothetical protein | - |
| MKY62_RS17995 (MKY62_17995) | - | 3445302..3447734 (-) | 2433 | WP_016886541.1 | phage/plasmid primase, P4 family | - |
| MKY62_RS18000 (MKY62_18000) | - | 3447795..3448232 (-) | 438 | WP_003185383.1 | DUF669 domain-containing protein | - |
| MKY62_RS18005 (MKY62_18005) | - | 3448232..3449164 (-) | 933 | WP_011198320.1 | AAA family ATPase | - |
| MKY62_RS18010 (MKY62_18010) | - | 3449168..3449728 (-) | 561 | WP_016886540.1 | host-nuclease inhibitor Gam family protein | - |
| MKY62_RS18015 (MKY62_18015) | - | 3449820..3450062 (-) | 243 | WP_011198322.1 | hypothetical protein | - |
| MKY62_RS18020 (MKY62_18020) | - | 3450150..3450416 (-) | 267 | WP_009330095.1 | YqaH family protein | - |
| MKY62_RS18025 (MKY62_18025) | - | 3450479..3451030 (+) | 552 | WP_016886538.1 | hypothetical protein | - |
| MKY62_RS18030 (MKY62_18030) | - | 3451002..3451157 (-) | 156 | WP_155266364.1 | hypothetical protein | - |
| MKY62_RS18035 (MKY62_18035) | - | 3451283..3451837 (-) | 555 | WP_003185401.1 | hypothetical protein | - |
| MKY62_RS18040 (MKY62_18040) | - | 3451895..3452083 (-) | 189 | WP_016886536.1 | hypothetical protein | - |
| MKY62_RS18045 (MKY62_18045) | - | 3452215..3452403 (-) | 189 | WP_003185403.1 | helix-turn-helix domain-containing protein | - |
| MKY62_RS18050 (MKY62_18050) | - | 3452400..3453194 (-) | 795 | WP_016886535.1 | ORF6N domain-containing protein | - |
| MKY62_RS18055 (MKY62_18055) | - | 3453256..3453573 (+) | 318 | WP_016886534.1 | hypothetical protein | - |
| MKY62_RS18060 (MKY62_18060) | - | 3453536..3453805 (-) | 270 | WP_016886533.1 | hypothetical protein | - |
| MKY62_RS18065 (MKY62_18065) | - | 3453820..3454059 (-) | 240 | WP_016886532.1 | helix-turn-helix transcriptional regulator | - |
| MKY62_RS18070 (MKY62_18070) | - | 3454216..3454866 (+) | 651 | WP_016886531.1 | LexA family transcriptional regulator | - |
| MKY62_RS18075 (MKY62_18075) | - | 3454937..3456031 (+) | 1095 | WP_003185410.1 | site-specific integrase | - |
| MKY62_RS18085 (MKY62_18085) | smpB | 3456583..3457056 (-) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| MKY62_RS18090 (MKY62_18090) | rnr | 3457168..3459471 (-) | 2304 | WP_003185414.1 | ribonuclease R | - |
| MKY62_RS18095 (MKY62_18095) | - | 3459485..3460231 (-) | 747 | WP_011198329.1 | carboxylesterase | - |
| MKY62_RS18100 (MKY62_18100) | secG | 3460372..3460602 (-) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| MKY62_RS18105 (MKY62_18105) | abrB | 3460773..3461057 (-) | 285 | WP_003185421.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| MKY62_RS18110 (MKY62_18110) | - | 3461086..3461319 (-) | 234 | WP_085959538.1 | helix-turn-helix transcriptional regulator | - |
| MKY62_RS18115 (MKY62_18115) | - | 3461472..3461873 (+) | 402 | WP_009329609.1 | transcriptional regulator | - |
| MKY62_RS18120 (MKY62_18120) | - | 3462046..3462444 (+) | 399 | WP_009329610.1 | helix-turn-helix transcriptional regulator | - |
| MKY62_RS18125 (MKY62_18125) | - | 3462492..3463169 (-) | 678 | WP_003185432.1 | ABC transporter permease | - |
| MKY62_RS18130 (MKY62_18130) | opuCC | 3463186..3464103 (-) | 918 | WP_009329611.1 | osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC | - |
| MKY62_RS18135 (MKY62_18135) | - | 3464117..3464770 (-) | 654 | WP_009329612.1 | ABC transporter permease | - |
| MKY62_RS18140 (MKY62_18140) | - | 3464792..3465931 (-) | 1140 | WP_003185439.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10486.36 Da Isoelectric Point: 7.9620
>NTDB_id=966684 MKY62_RS18105 WP_003185421.1 3460773..3461057(-) (abrB) [Bacillus sp. FSL R7-0646]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=966684 MKY62_RS18105 WP_003185421.1 3460773..3461057(-) (abrB) [Bacillus sp. FSL R7-0646]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.044 |
96.809 |
0.543 |