Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ10_RS14920 Genome accession   NZ_CP150196
Coordinates   2870802..2870942 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0432     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2865802..2875942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ10_RS14895 (NSQ10_14895) - 2866124..2866513 (-) 390 WP_039181120.1 hotdog fold thioesterase -
  NSQ10_RS14900 (NSQ10_14900) comA 2866537..2867178 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  NSQ10_RS14905 (NSQ10_14905) comP 2867259..2869565 (-) 2307 WP_039181123.1 ATP-binding protein Regulator
  NSQ10_RS14910 (NSQ10_14910) comX 2869579..2869749 (-) 171 WP_034317154.1 competence pheromone ComX -
  NSQ10_RS14915 (NSQ10_14915) - 2869727..2870650 (-) 924 WP_039181129.1 polyprenyl synthetase family protein -
  NSQ10_RS14920 (NSQ10_14920) degQ 2870802..2870942 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSQ10_RS14925 (NSQ10_14925) - 2871448..2871804 (+) 357 WP_039181132.1 hypothetical protein -
  NSQ10_RS14930 (NSQ10_14930) - 2871840..2873066 (-) 1227 WP_039181134.1 HDOD domain-containing protein -
  NSQ10_RS14935 (NSQ10_14935) - 2873204..2874676 (-) 1473 WP_039181137.1 nicotinate phosphoribosyltransferase -
  NSQ10_RS14940 (NSQ10_14940) - 2874694..2875245 (-) 552 WP_039181140.1 isochorismatase family cysteine hydrolase -
  NSQ10_RS14945 (NSQ10_14945) - 2875306..2875713 (-) 408 WP_039181143.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=965934 NSQ10_RS14920 WP_003213123.1 2870802..2870942(-) (degQ) [Bacillus sp. FSL R5-0432]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965934 NSQ10_RS14920 WP_003213123.1 2870802..2870942(-) (degQ) [Bacillus sp. FSL R5-0432]
ATGGAAAAGTATGAAATCGAAGAGCTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment