Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NST56_RS13700 Genome accession   NZ_CP150195
Coordinates   2585378..2585725 (-) Length   115 a.a.
NCBI ID   WP_168748233.1    Uniprot ID   -
Organism   Bacillus sp. FSL R5-0560     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2580378..2590725
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST56_RS13655 (NST56_13655) sinI 2580903..2581076 (+) 174 WP_010334916.1 anti-repressor SinI family protein Regulator
  NST56_RS13660 (NST56_13660) sinR 2581110..2581445 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NST56_RS13665 (NST56_13665) tasA 2581533..2582318 (-) 786 WP_168748227.1 biofilm matrix protein TasA -
  NST56_RS13670 (NST56_13670) - 2582383..2582967 (-) 585 WP_339177148.1 signal peptidase I -
  NST56_RS13675 (NST56_13675) tapA 2582939..2583700 (-) 762 WP_339177150.1 amyloid fiber anchoring/assembly protein TapA -
  NST56_RS13680 (NST56_13680) - 2583977..2584300 (+) 324 WP_168748230.1 YqzG/YhdC family protein -
  NST56_RS13685 (NST56_13685) - 2584343..2584522 (-) 180 WP_003236949.1 YqzE family protein -
  NST56_RS13690 (NST56_13690) comGG 2584594..2584968 (-) 375 WP_339177153.1 competence type IV pilus minor pilin ComGG Machinery gene
  NST56_RS13695 (NST56_13695) comGF 2584969..2585352 (-) 384 WP_339177156.1 competence type IV pilus minor pilin ComGF Machinery gene
  NST56_RS13700 (NST56_13700) comGE 2585378..2585725 (-) 348 WP_168748233.1 competence type IV pilus minor pilin ComGE Machinery gene
  NST56_RS13705 (NST56_13705) comGD 2585709..2586140 (-) 432 WP_168748234.1 competence type IV pilus minor pilin ComGD Machinery gene
  NST56_RS13710 (NST56_13710) comGC 2586130..2586426 (-) 297 WP_168748235.1 competence type IV pilus major pilin ComGC Machinery gene
  NST56_RS13715 (NST56_13715) comGB 2586440..2587477 (-) 1038 WP_326191101.1 competence type IV pilus assembly protein ComGB Machinery gene
  NST56_RS13720 (NST56_13720) comGA 2587464..2588534 (-) 1071 WP_168748237.1 competence protein ComGA Machinery gene
  NST56_RS13725 (NST56_13725) - 2588887..2589057 (-) 171 WP_339177165.1 hypothetical protein -
  NST56_RS13730 (NST56_13730) - 2589281..2590231 (-) 951 WP_010334929.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13254.06 Da        Isoelectric Point: 4.3440

>NTDB_id=965852 NST56_RS13700 WP_168748233.1 2585378..2585725(-) (comGE) [Bacillus sp. FSL R5-0560]
MWRENKGFSTIETMSALSIWLFMLLTIVPMWDKLIADEHIADSREIGYQLVNESIGQYMLTGAGNSSKTVSMNNNKYSMT
WEEEGEYQNVCISSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=965852 NST56_RS13700 WP_168748233.1 2585378..2585725(-) (comGE) [Bacillus sp. FSL R5-0560]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGTCTGCCCTTAGCATATGGCTGTTTATGCTTCTGACAAT
TGTGCCGATGTGGGATAAGCTGATAGCTGATGAACATATAGCGGACTCCAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCCAATATATGCTGACAGGGGCAGGAAATTCATCAAAGACTGTTTCAATGAACAATAACAAATACTCGATGACA
TGGGAGGAGGAGGGAGAATATCAAAACGTATGTATCTCATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

71.304

100

0.713

Multiple sequence alignment