Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   NSQ23_RS05320 Genome accession   NZ_CP150179
Coordinates   1010028..1010324 (+) Length   98 a.a.
NCBI ID   WP_339173533.1    Uniprot ID   -
Organism   Anoxybacillus sp. FSL W8-1294     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1005028..1015324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ23_RS05295 (NSQ23_05295) - 1005479..1006549 (+) 1071 WP_339173526.1 SAM-dependent methyltransferase -
  NSQ23_RS05300 (NSQ23_05300) - 1006579..1006821 (-) 243 WP_192948263.1 DUF2626 domain-containing protein -
  NSQ23_RS05305 (NSQ23_05305) - 1006891..1007589 (-) 699 WP_004889538.1 helix-turn-helix domain-containing protein -
  NSQ23_RS05310 (NSQ23_05310) comGA 1007929..1008999 (+) 1071 WP_339173529.1 competence type IV pilus ATPase ComGA Machinery gene
  NSQ23_RS05315 (NSQ23_05315) comGB 1008983..1010014 (+) 1032 WP_339173531.1 competence type IV pilus assembly protein ComGB -
  NSQ23_RS05320 (NSQ23_05320) comGC 1010028..1010324 (+) 297 WP_339173533.1 competence type IV pilus major pilin ComGC Machinery gene
  NSQ23_RS05325 (NSQ23_05325) comGD 1010317..1010754 (+) 438 WP_339173535.1 competence type IV pilus minor pilin ComGD -
  NSQ23_RS05330 (NSQ23_05330) comGE 1010738..1011046 (+) 309 WP_339173538.1 competence type IV pilus minor pilin ComGE -
  NSQ23_RS05335 (NSQ23_05335) comGF 1011043..1011477 (+) 435 WP_004889548.1 competence type IV pilus minor pilin ComGF -
  NSQ23_RS05340 (NSQ23_05340) comGG 1011521..1011853 (+) 333 WP_339173541.1 competence type IV pilus minor pilin ComGG -
  NSQ23_RS05345 (NSQ23_05345) - 1011868..1012374 (+) 507 WP_004889550.1 shikimate kinase -
  NSQ23_RS05350 (NSQ23_05350) - 1012401..1012589 (+) 189 WP_004889551.1 YqzE family protein -
  NSQ23_RS05355 (NSQ23_05355) - 1012604..1013374 (-) 771 WP_339173543.1 YqhG family protein -
  NSQ23_RS05360 (NSQ23_05360) - 1013361..1015004 (-) 1644 WP_339173545.1 SNF2-related protein -

Sequence


Protein


Download         Length: 98 a.a.        Molecular weight: 11103.07 Da        Isoelectric Point: 5.8204

>NTDB_id=965177 NSQ23_RS05320 WP_339173533.1 1010028..1010324(+) (comGC) [Anoxybacillus sp. FSL W8-1294]
MRNEKGFTLIEMLIVLMVITILILITIPNVTKHNSMINNKGCSAFIKMVQSQVKAYEMEYGTIPTVQQLVDRKYIESNRC
PNGKEIVITNEGDVLEGE

Nucleotide


Download         Length: 297 bp        

>NTDB_id=965177 NSQ23_RS05320 WP_339173533.1 1010028..1010324(+) (comGC) [Anoxybacillus sp. FSL W8-1294]
ATGCGAAATGAGAAAGGGTTTACATTAATTGAAATGTTAATTGTGCTAATGGTTATCACAATTTTAATTTTAATTACGAT
TCCAAATGTGACAAAACATAACAGCATGATTAACAACAAAGGGTGTTCGGCTTTTATAAAAATGGTTCAGTCTCAAGTGA
AAGCGTACGAAATGGAATACGGAACAATCCCGACTGTGCAACAATTAGTAGATAGAAAATATATTGAGAGCAACCGTTGC
CCAAATGGAAAAGAGATCGTTATTACAAATGAAGGAGACGTTTTAGAAGGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

53.933

90.816

0.49


Multiple sequence alignment