Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAA995_RS02655 | Genome accession | NZ_AP028877 |
| Coordinates | 511774..511923 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 21P20 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 506774..516923
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA995_RS02605 (SP21P20_05100) | comA/nlmT | 506820..507407 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| AAA995_RS02610 (SP21P20_05110) | blpI | 507689..507886 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| AAA995_RS02615 (SP21P20_05130) | blpJ | 508353..508622 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| AAA995_RS02620 (SP21P20_05140) | blpU | 508691..508921 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| AAA995_RS02625 | - | 508924..509043 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| AAA995_RS02630 (SP21P20_05150) | - | 509340..509504 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| AAA995_RS02635 (SP21P20_05160) | - | 509501..509905 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| AAA995_RS02640 | - | 510103..510907 (+) | 805 | Protein_519 | IS5 family transposase | - |
| AAA995_RS02645 (SP21P20_05200) | blpM | 511057..511311 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| AAA995_RS02650 (SP21P20_05210) | blpN | 511327..511530 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| AAA995_RS02655 (SP21P20_05220) | cipB | 511774..511923 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| AAA995_RS02660 | - | 512027..512146 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AAA995_RS02665 (SP21P20_05240) | - | 512932..513351 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| AAA995_RS02670 (SP21P20_05250) | - | 513366..514055 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAA995_RS02675 (SP21P20_05260) | blpZ | 514097..514330 (+) | 234 | WP_001809974.1 | immunity protein BlpZ | - |
| AAA995_RS02680 | - | 514481..515092 (+) | 612 | WP_000394038.1 | type II CAAX endopeptidase family protein | - |
| AAA995_RS02685 (SP21P20_05270) | - | 515253..516047 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| AAA995_RS02690 (SP21P20_05280) | trmB | 516044..516679 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=96466 AAA995_RS02655 WP_001809846.1 511774..511923(+) (cipB) [Streptococcus pneumoniae strain 21P20]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=96466 AAA995_RS02655 WP_001809846.1 511774..511923(+) (cipB) [Streptococcus pneumoniae strain 21P20]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |