Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   NST88_RS13200 Genome accession   NZ_CP150162
Coordinates   2560739..2561149 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. PS68     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2556105..2607595 2560739..2561149 within 0


Gene organization within MGE regions


Location: 2556105..2607595
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST88_RS13175 (NST88_13175) - 2556272..2557003 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  NST88_RS13180 (NST88_13180) cwlH 2557255..2558007 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  NST88_RS13185 (NST88_13185) - 2558194..2558820 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  NST88_RS13190 (NST88_13190) gnd 2558839..2559732 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  NST88_RS13195 (NST88_13195) - 2559984..2560706 (+) 723 WP_010886572.1 hypothetical protein -
  NST88_RS13200 (NST88_13200) nucA/comI 2560739..2561149 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  NST88_RS13205 (NST88_13205) - 2561345..2561692 (+) 348 Protein_2552 sigma-70 family RNA polymerase sigma factor -
  NST88_RS13210 (NST88_13210) spoIVCA 2561723..2563183 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  NST88_RS13215 (NST88_13215) - 2563141..2563319 (-) 179 Protein_2554 hypothetical protein -
  NST88_RS13220 (NST88_13220) - 2563674..2564093 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  NST88_RS13225 (NST88_13225) acr3 2564105..2565145 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  NST88_RS13230 (NST88_13230) - 2565168..2565608 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  NST88_RS13235 (NST88_13235) arsR 2565669..2565986 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  NST88_RS13240 (NST88_13240) - 2566358..2567122 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  NST88_RS13245 (NST88_13245) rapE 2567565..2568692 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  NST88_RS13250 (NST88_13250) phrE 2568682..2568816 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  NST88_RS13255 (NST88_13255) - 2568926..2569084 (+) 159 WP_003245945.1 hypothetical protein -
  NST88_RS13260 (NST88_13260) yqcG 2569454..2571049 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  NST88_RS13265 (NST88_13265) yqcF 2571064..2571642 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  NST88_RS13270 (NST88_13270) - 2571760..2571906 (+) 147 WP_009967791.1 hypothetical protein -
  NST88_RS13275 (NST88_13275) - 2571903..2572265 (-) 363 WP_003229947.1 hypothetical protein -
  NST88_RS13280 (NST88_13280) - 2572281..2572760 (-) 480 WP_004399085.1 hypothetical protein -
  NST88_RS13285 (NST88_13285) cwlA 2572925..2573743 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  NST88_RS13290 (NST88_13290) - 2573788..2574210 (-) 423 WP_003246208.1 holin family protein -
  NST88_RS13295 (NST88_13295) - 2574255..2575148 (-) 894 WP_003246010.1 hypothetical protein -
  NST88_RS13300 (NST88_13300) - 2575236..2575400 (-) 165 WP_003229944.1 XkdX family protein -
  NST88_RS13305 (NST88_13305) - 2575397..2575732 (-) 336 WP_009967793.1 XkdW family protein -
  NST88_RS13310 (NST88_13310) - 2575742..2576842 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  NST88_RS13315 (NST88_13315) - 2576845..2577117 (-) 273 WP_003229942.1 hypothetical protein -
  NST88_RS13320 (NST88_13320) - 2577114..2577692 (-) 579 WP_003229941.1 YmfQ family protein -
  NST88_RS13325 (NST88_13325) - 2577676..2578722 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  NST88_RS13330 (NST88_13330) - 2578715..2579140 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  NST88_RS13335 (NST88_13335) - 2579153..2579416 (-) 264 WP_003229938.1 DUF2577 family protein -
  NST88_RS13340 (NST88_13340) - 2579413..2580393 (-) 981 WP_004398524.1 hypothetical protein -
  NST88_RS13345 (NST88_13345) - 2580406..2581065 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  NST88_RS13350 (NST88_13350) - 2581058..2585815 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  NST88_RS13355 (NST88_13355) - 2585818..2585955 (-) 138 WP_003229934.1 hypothetical protein -
  NST88_RS13360 (NST88_13360) - 2585997..2586446 (-) 450 WP_003229933.1 phage portal protein -
  NST88_RS13365 (NST88_13365) txpA 2586592..2586771 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  NST88_RS13370 (NST88_13370) bsrH 2587151..2587240 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  NST88_RS13375 (NST88_13375) - 2587494..2587937 (-) 444 WP_003229930.1 phage tail tube protein -
  NST88_RS13380 (NST88_13380) - 2587940..2589340 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  NST88_RS13385 (NST88_13385) - 2589341..2589532 (-) 192 WP_010886574.1 hypothetical protein -
  NST88_RS13390 (NST88_13390) - 2589529..2589966 (-) 438 WP_003229927.1 DUF6838 family protein -
  NST88_RS13395 (NST88_13395) - 2589979..2590482 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  NST88_RS13400 (NST88_13400) - 2590479..2590841 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  NST88_RS13405 (NST88_13405) - 2590838..2591233 (-) 396 WP_004398566.1 DUF3199 family protein -
  NST88_RS13410 (NST88_13410) - 2591237..2591548 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  NST88_RS13415 (NST88_13415) - 2591559..2592494 (-) 936 WP_003229922.1 phage major capsid protein -
  NST88_RS13420 (NST88_13420) - 2592513..2593481 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  NST88_RS13425 (NST88_13425) - 2593514..2594167 (-) 654 WP_003229920.1 hypothetical protein -
  NST88_RS13430 (NST88_13430) - 2594208..2595125 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  NST88_RS13435 (NST88_13435) - 2595122..2596654 (-) 1533 WP_004398894.1 phage portal protein -
  NST88_RS13440 (NST88_13440) - 2596658..2597953 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  NST88_RS13445 (NST88_13445) terS 2597946..2598665 (-) 720 WP_003229916.1 phage terminase small subunit -
  NST88_RS13450 (NST88_13450) - 2598733..2599197 (-) 465 WP_004398685.1 hypothetical protein -
  NST88_RS13455 (NST88_13455) - 2599341..2599796 (-) 456 WP_004398775.1 hypothetical protein -
  NST88_RS13460 (NST88_13460) - 2599994..2600923 (+) 930 WP_003229913.1 hypothetical protein -
  NST88_RS13465 (NST88_13465) - 2600997..2601203 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  NST88_RS13470 (NST88_13470) - 2601285..2601713 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  NST88_RS13475 (NST88_13475) - 2601809..2601958 (-) 150 WP_003229910.1 hypothetical protein -
  NST88_RS13480 (NST88_13480) - 2601949..2602890 (-) 942 WP_075058863.1 ATP-binding protein -
  NST88_RS13485 (NST88_13485) - 2602772..2603449 (-) 678 WP_116362964.1 DnaD domain protein -
  NST88_RS13490 (NST88_13490) - 2603525..2604379 (-) 855 WP_003229907.1 recombinase RecT -
  NST88_RS13495 (NST88_13495) - 2604382..2605341 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  NST88_RS13500 (NST88_13500) - 2605447..2605641 (-) 195 WP_003229905.1 hypothetical protein -
  NST88_RS13505 (NST88_13505) - 2605601..2605774 (-) 174 WP_119123069.1 hypothetical protein -
  NST88_RS13510 (NST88_13510) - 2605771..2606028 (-) 258 WP_003245994.1 YqaH family protein -
  NST88_RS13515 (NST88_13515) - 2606025..2606594 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  NST88_RS13520 (NST88_13520) - 2606668..2606808 (-) 141 WP_003229902.1 hypothetical protein -
  NST88_RS13525 (NST88_13525) - 2606838..2607068 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  NST88_RS13530 (NST88_13530) sknR 2607245..2607595 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=964246 NST88_RS13200 WP_009967785.1 2560739..2561149(-) (nucA/comI) [Bacillus sp. PS68]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=964246 NST88_RS13200 WP_009967785.1 2560739..2561149(-) (nucA/comI) [Bacillus sp. PS68]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment