Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NSS90_RS12665 Genome accession   NZ_CP150161
Coordinates   2464830..2465213 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus sp. PS93     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2459830..2470213
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS90_RS12625 (NSS90_12625) sinI 2460764..2460937 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSS90_RS12630 (NSS90_12630) sinR 2460971..2461306 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSS90_RS12635 (NSS90_12635) tasA 2461399..2462184 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  NSS90_RS12640 (NSS90_12640) - 2462248..2462820 (-) 573 WP_003230181.1 signal peptidase I -
  NSS90_RS12645 (NSS90_12645) tapA 2462804..2463565 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSS90_RS12650 (NSS90_12650) - 2463837..2464163 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSS90_RS12655 (NSS90_12655) - 2464205..2464384 (-) 180 WP_072175549.1 YqzE family protein -
  NSS90_RS12660 (NSS90_12660) comGG 2464455..2464829 (-) 375 WP_167408283.1 ComG operon protein ComGG Machinery gene
  NSS90_RS12665 (NSS90_12665) comGF 2464830..2465213 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NSS90_RS12670 (NSS90_12670) comGE 2465239..2465586 (-) 348 WP_167408284.1 ComG operon protein 5 Machinery gene
  NSS90_RS12675 (NSS90_12675) comGD 2465570..2466001 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  NSS90_RS12680 (NSS90_12680) comGC 2465991..2466287 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  NSS90_RS12685 (NSS90_12685) comGB 2466301..2467338 (-) 1038 WP_339174855.1 comG operon protein ComGB Machinery gene
  NSS90_RS12690 (NSS90_12690) comGA 2467325..2468395 (-) 1071 WP_069322755.1 competence protein ComGA Machinery gene
  NSS90_RS12695 (NSS90_12695) - 2468657..2468806 (-) 150 WP_250540178.1 hypothetical protein -
  NSS90_RS12700 (NSS90_12700) corA 2468808..2469761 (-) 954 WP_339174859.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=964152 NSS90_RS12665 WP_032726158.1 2464830..2465213(-) (comGF) [Bacillus sp. PS93]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=964152 NSS90_RS12665 WP_032726158.1 2464830..2465213(-) (comGF) [Bacillus sp. PS93]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment