Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   NST94_RS22295 Genome accession   NZ_CP150146
Coordinates   5136307..5136744 (+) Length   145 a.a.
NCBI ID   WP_339169277.1    Uniprot ID   -
Organism   Paenibacillus sp. FSL H8-0282     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 5104402..5142222 5136307..5136744 within 0


Gene organization within MGE regions


Location: 5104402..5142222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST94_RS22090 (NST94_22090) - 5104402..5105412 (-) 1011 WP_036683303.1 glycoside hydrolase family 130 protein -
  NST94_RS22095 (NST94_22095) - 5105469..5106305 (-) 837 WP_036683306.1 carbohydrate ABC transporter permease -
  NST94_RS22100 (NST94_22100) - 5106320..5107222 (-) 903 WP_036683309.1 sugar ABC transporter permease -
  NST94_RS22105 (NST94_22105) - 5107327..5108709 (-) 1383 WP_036683312.1 extracellular solute-binding protein -
  NST94_RS22110 (NST94_22110) - 5108882..5110513 (-) 1632 WP_339244442.1 response regulator -
  NST94_RS22115 (NST94_22115) - 5110517..5112325 (-) 1809 WP_036683317.1 sensor histidine kinase -
  NST94_RS22120 (NST94_22120) - 5112526..5112813 (+) 288 WP_076187406.1 hypothetical protein -
  NST94_RS22125 (NST94_22125) - 5112955..5113245 (-) 291 WP_076317110.1 helix-turn-helix transcriptional regulator -
  NST94_RS22130 (NST94_22130) - 5113450..5113710 (-) 261 WP_256717515.1 hypothetical protein -
  NST94_RS22135 (NST94_22135) - 5113704..5114126 (-) 423 WP_076187410.1 hypothetical protein -
  NST94_RS22140 (NST94_22140) - 5114189..5114485 (-) 297 WP_339281293.1 hypothetical protein -
  NST94_RS22145 (NST94_22145) - 5114545..5114745 (-) 201 WP_339281294.1 hypothetical protein -
  NST94_RS22150 (NST94_22150) - 5114924..5115421 (-) 498 WP_076187414.1 sigma-70 family RNA polymerase sigma factor -
  NST94_RS22155 (NST94_22155) - 5115597..5116721 (-) 1125 WP_339281295.1 M56 family metallopeptidase -
  NST94_RS22160 (NST94_22160) - 5116723..5117091 (-) 369 WP_036683325.1 BlaI/MecI/CopY family transcriptional regulator -
  NST94_RS22165 (NST94_22165) - 5117395..5118063 (+) 669 WP_036683328.1 hypothetical protein -
  NST94_RS22170 (NST94_22170) - 5118326..5119918 (-) 1593 WP_339281296.1 sensor domain-containing diguanylate cyclase -
  NST94_RS22180 (NST94_22180) - 5120594..5121544 (-) 951 WP_339281297.1 DUF4435 domain-containing protein -
  NST94_RS22185 (NST94_22185) - 5121531..5122880 (-) 1350 WP_339281298.1 AAA family ATPase -
  NST94_RS22190 (NST94_22190) radC 5123361..5123969 (+) 609 WP_339281299.1 DNA repair protein RadC -
  NST94_RS22195 (NST94_22195) - 5124159..5124518 (+) 360 WP_339281300.1 helix-turn-helix transcriptional regulator -
  NST94_RS22200 (NST94_22200) - 5124533..5125477 (+) 945 WP_339281301.1 hypothetical protein -
  NST94_RS22205 (NST94_22205) - 5125513..5125740 (+) 228 WP_339281302.1 hypothetical protein -
  NST94_RS22210 (NST94_22210) - 5125815..5125994 (+) 180 WP_339281303.1 hypothetical protein -
  NST94_RS22215 (NST94_22215) - 5126023..5126151 (+) 129 WP_339281304.1 hypothetical protein -
  NST94_RS22220 (NST94_22220) - 5126201..5126566 (-) 366 WP_339281305.1 hypothetical protein -
  NST94_RS22225 (NST94_22225) - 5126563..5127228 (-) 666 WP_339281306.1 hypothetical protein -
  NST94_RS22230 (NST94_22230) - 5127375..5128439 (-) 1065 WP_339281307.1 hypothetical protein -
  NST94_RS22235 (NST94_22235) - 5128790..5128990 (+) 201 WP_076103801.1 helix-turn-helix domain-containing protein -
  NST94_RS22240 (NST94_22240) - 5129071..5130240 (+) 1170 WP_339281308.1 tyrosine-type recombinase/integrase -
  NST94_RS22245 (NST94_22245) - 5130237..5130431 (+) 195 WP_339281309.1 hypothetical protein -
  NST94_RS22255 (NST94_22255) - 5130839..5131315 (-) 477 WP_248549351.1 WGxxGxxG-CTERM domain-containing protein -
  NST94_RS22260 (NST94_22260) - 5131391..5132077 (-) 687 WP_339281310.1 M15 family metallopeptidase -
  NST94_RS22265 (NST94_22265) - 5132195..5132359 (+) 165 WP_169744799.1 hypothetical protein -
  NST94_RS22270 (NST94_22270) - 5132356..5132691 (-) 336 WP_076142249.1 YolD-like family protein -
  NST94_RS22275 (NST94_22275) - 5132906..5133466 (-) 561 WP_076128860.1 hypothetical protein -
  NST94_RS22280 (NST94_22280) - 5133584..5134072 (+) 489 WP_076128858.1 PH domain-containing protein -
  NST94_RS22285 (NST94_22285) - 5134145..5135620 (-) 1476 WP_339281311.1 glycosyl hydrolase -
  NST94_RS22290 (NST94_22290) - 5135790..5136206 (-) 417 WP_076103796.1 cytidine deaminase -
  NST94_RS22295 (NST94_22295) nucA/comI 5136307..5136744 (+) 438 WP_339169277.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  NST94_RS22300 (NST94_22300) - 5136826..5136975 (-) 150 WP_155288175.1 hypothetical protein -
  NST94_RS22305 (NST94_22305) - 5137125..5137301 (+) 177 WP_076098563.1 YjfB family protein -
  NST94_RS22310 (NST94_22310) - 5137465..5138016 (+) 552 WP_036683410.1 ImmA/IrrE family metallo-endopeptidase -
  NST94_RS22315 (NST94_22315) - 5138083..5138244 (+) 162 WP_155288176.1 hypothetical protein -
  NST94_RS22320 (NST94_22320) - 5138610..5138945 (+) 336 WP_076192025.1 DUF3139 domain-containing protein -
  NST94_RS22325 (NST94_22325) - 5139042..5139179 (+) 138 Protein_4400 phosphomethylpyrimidine synthase ThiC -
  NST94_RS22330 (NST94_22330) - 5139513..5140007 (+) 495 WP_076220021.1 sigma-70 family RNA polymerase sigma factor -
  NST94_RS22335 (NST94_22335) - 5140004..5140993 (+) 990 WP_339281312.1 hypothetical protein -
  NST94_RS22340 (NST94_22340) - 5141719..5142222 (-) 504 WP_076192030.1 hypothetical protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16168.11 Da        Isoelectric Point: 4.5847

>NTDB_id=963328 NST94_RS22295 WP_339169277.1 5136307..5136744(+) (nucA/comI) [Paenibacillus sp. FSL H8-0282]
MKVKKWISSLIIVVLLALASYWFEQNGEPTDPSSPSDSSVVQLTFPSDRYPETAKHIQDAIAKGESATCTINREQAEENR
KESLKGIPTKKGYDRDEWPMAMCKEGGIGADIEYITPSDNRGAGSWVGNQLEDYADGTRVEFMFK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=963328 NST94_RS22295 WP_339169277.1 5136307..5136744(+) (nucA/comI) [Paenibacillus sp. FSL H8-0282]
TTGAAAGTAAAAAAATGGATCTCCAGTCTCATCATTGTTGTATTACTTGCTTTGGCTAGTTACTGGTTTGAACAAAACGG
AGAGCCTACAGACCCCTCGTCTCCATCCGATTCGAGTGTTGTTCAGCTAACCTTCCCATCAGACCGCTATCCTGAGACCG
CCAAACATATTCAGGATGCCATTGCGAAAGGTGAATCCGCCACATGTACGATTAACCGAGAGCAGGCTGAAGAGAACCGT
AAAGAGTCCTTAAAAGGGATTCCCACTAAAAAGGGGTATGACCGGGATGAATGGCCAATGGCTATGTGTAAGGAAGGCGG
CATTGGTGCCGACATTGAATACATAACGCCAAGCGATAACCGCGGGGCAGGAAGCTGGGTTGGCAATCAGCTGGAGGATT
ATGCAGACGGAACGCGGGTAGAATTTATGTTTAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

69.903

71.034

0.497