Detailed information
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | OW489_RS07890 | Genome accession | NZ_AP026446 |
| Coordinates | 1643145..1643429 (+) | Length | 94 a.a. |
| NCBI ID | WP_000736478.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain CHC155 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1631899..1689492 | 1643145..1643429 | within | 0 |
Gene organization within MGE regions
Location: 1631899..1689492
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW489_RS07830 (CHC155_15300) | - | 1632210..1633217 (+) | 1008 | WP_267285997.1 | ferrochelatase | - |
| OW489_RS07835 (CHC155_15310) | cmoB | 1633221..1634006 (+) | 786 | WP_120857421.1 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | - |
| OW489_RS07840 (CHC155_15320) | - | 1634023..1634451 (+) | 429 | WP_001158247.1 | hotdog domain-containing protein | - |
| OW489_RS07845 (CHC155_15330) | - | 1634456..1635625 (+) | 1170 | WP_267285998.1 | glycosyltransferase family 4 protein | - |
| OW489_RS07850 (CHC155_15340) | speA | 1635640..1637487 (+) | 1848 | WP_001158557.1 | arginine decarboxylase | - |
| OW489_RS07855 (CHC155_15350) | - | 1637609..1638484 (-) | 876 | WP_120857427.1 | hypothetical protein | - |
| OW489_RS08160 | - | 1638589..1640436 (-) | 1848 | Protein_1541 | hypothetical protein | - |
| OW489_RS07875 (CHC155_15390) | - | 1640481..1641646 (-) | 1166 | Protein_1542 | DHH family protein | - |
| OW489_RS07880 (CHC155_15410) | - | 1641777..1642565 (+) | 789 | WP_120856481.1 | integrase | - |
| OW489_RS07885 (CHC155_15420) | - | 1642669..1643148 (+) | 480 | WP_162966579.1 | hypothetical protein | - |
| OW489_RS07890 (CHC155_15430) | comB2 | 1643145..1643429 (+) | 285 | WP_000736478.1 | TrbC/VirB2 family protein | Machinery gene |
| OW489_RS07895 (CHC155_15440) | comB3 | 1643440..1643703 (+) | 264 | WP_001177712.1 | hypothetical protein | Machinery gene |
| OW489_RS07900 (CHC155_15450) | - | 1643714..1643950 (+) | 237 | WP_120824245.1 | hypothetical protein | - |
| OW489_RS07905 (CHC155_15460) | - | 1643950..1646532 (+) | 2583 | WP_120856479.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| OW489_RS07910 | - | 1646529..1646663 (+) | 135 | WP_120856477.1 | type IV secretion system protein VirB7 | - |
| OW489_RS07915 (CHC155_15470) | - | 1646656..1647825 (+) | 1170 | WP_120856475.1 | VirB8/TrbF family protein | - |
| OW489_RS07920 (CHC155_15480) | - | 1647822..1649498 (+) | 1677 | WP_120856473.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| OW489_RS07925 (CHC155_15490) | comB10 | 1649495..1650697 (+) | 1203 | WP_120856471.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| OW489_RS07930 (CHC155_15500) | - | 1650681..1652930 (+) | 2250 | WP_120856469.1 | collagen-like protein | - |
| OW489_RS07935 (CHC155_15510) | - | 1652943..1653920 (+) | 978 | WP_120824239.1 | hypothetical protein | - |
| OW489_RS07940 (CHC155_15520) | - | 1653938..1654210 (+) | 273 | WP_205583491.1 | hypothetical protein | - |
| OW489_RS07945 (CHC155_15530) | - | 1654215..1655159 (+) | 945 | WP_120824237.1 | CpaF/VirB11 family protein | - |
| OW489_RS07950 (CHC155_15540) | - | 1655156..1655674 (+) | 519 | WP_120824236.1 | replication regulatory RepB family protein | - |
| OW489_RS07955 (CHC155_15550) | - | 1655671..1657935 (+) | 2265 | WP_120824235.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OW489_RS07960 (CHC155_15560) | - | 1657955..1666555 (+) | 8601 | WP_120856467.1 | SNF2-related protein | - |
| OW489_RS07965 (CHC155_15570) | - | 1666890..1668950 (+) | 2061 | WP_120856465.1 | type IA DNA topoisomerase | - |
| OW489_RS07970 (CHC155_15580) | - | 1669005..1669475 (+) | 471 | WP_000965788.1 | hypothetical protein | - |
| OW489_RS07975 | - | 1669445..1670235 (+) | 791 | Protein_1562 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| OW489_RS07980 (CHC155_15610) | - | 1670357..1670929 (-) | 573 | WP_120856463.1 | hypothetical protein | - |
| OW489_RS07985 (CHC155_15620) | - | 1670907..1671284 (-) | 378 | WP_120856461.1 | hypothetical protein | - |
| OW489_RS07990 (CHC155_15630) | - | 1671346..1671996 (-) | 651 | WP_120824227.1 | ParA family protein | - |
| OW489_RS07995 (CHC155_15640) | - | 1672634..1672798 (+) | 165 | WP_015427674.1 | hypothetical protein | - |
| OW489_RS08000 (CHC155_15650) | - | 1672799..1673866 (+) | 1068 | WP_120824226.1 | ArdC family protein | - |
| OW489_RS08005 (CHC155_15660) | - | 1673866..1675872 (+) | 2007 | WP_120928866.1 | hypothetical protein | - |
| OW489_RS08010 (CHC155_15670) | - | 1675882..1677315 (+) | 1434 | WP_267286001.1 | hypothetical protein | - |
| OW489_RS08015 (CHC155_15680) | - | 1677312..1678562 (+) | 1251 | WP_267286002.1 | P-type conjugative transfer protein TrbL | - |
| OW489_RS08020 (CHC155_15690) | - | 1678559..1679815 (+) | 1257 | WP_267286003.1 | hypothetical protein | - |
| OW489_RS08025 (CHC155_15700) | - | 1679837..1680565 (-) | 729 | WP_120858363.1 | hypothetical protein | - |
| OW489_RS08030 (CHC155_15710) | ctkA | 1680794..1681771 (+) | 978 | WP_120858365.1 | serine/threonine-protein kinase CtkA | - |
| OW489_RS08035 (CHC155_15720) | - | 1682089..1683156 (-) | 1068 | WP_120824220.1 | tyrosine-type recombinase/integrase | - |
| OW489_RS08040 (CHC155_15730) | - | 1684232..1686232 (-) | 2001 | WP_205583492.1 | relaxase/mobilization nuclease domain-containing protein | - |
| OW489_RS08045 (CHC155_15740) | - | 1687149..1688225 (-) | 1077 | Protein_1576 | HsdR family type I site-specific deoxyribonuclease | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10683.00 Da Isoelectric Point: 10.9123
>NTDB_id=96322 OW489_RS07890 WP_000736478.1 1643145..1643429(+) (comB2) [Helicobacter pylori strain CHC155]
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=96322 OW489_RS07890 WP_000736478.1 1643145..1643429(+) (comB2) [Helicobacter pylori strain CHC155]
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.143 |
96.809 |
0.553 |