Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   WKR14_RS21365 Genome accession   NZ_CP149966
Coordinates   1021483..1021794 (+) Length   103 a.a.
NCBI ID   WP_420884226.1    Uniprot ID   -
Organism   Shewanella chilikensis strain ST10     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1003055..1039436 1021483..1021794 within 0


Gene organization within MGE regions


Location: 1003055..1039436
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKR14_RS04685 (WKR14_04685) - 1003855..1004562 (+) 708 WP_165564556.1 ankyrin repeat domain-containing protein -
  WKR14_RS04690 (WKR14_04690) - 1004591..1005505 (+) 915 WP_335921809.1 hypothetical protein -
  WKR14_RS04695 (WKR14_04695) - 1005521..1006441 (+) 921 WP_287591645.1 DUF4123 domain-containing protein -
  WKR14_RS21350 - 1007671..1007952 (+) 282 Protein_896 DUF6531 domain-containing protein -
  WKR14_RS21355 - 1009067..1009111 (-) 45 WP_407820373.1 hypothetical protein -
  WKR14_RS21360 - 1010812..1011432 (+) 621 Protein_898 RHS repeat-associated core domain-containing protein -
  WKR14_RS04705 (WKR14_04705) - 1011429..1012004 (+) 576 WP_339087446.1 hypothetical protein -
  WKR14_RS04710 (WKR14_04710) - 1012444..1013394 (+) 951 WP_001107060.1 IS30 family transposase -
  WKR14_RS04715 (WKR14_04715) - 1013787..1014584 (+) 798 WP_339087447.1 hypothetical protein -
  WKR14_RS04720 (WKR14_04720) - 1014998..1015690 (+) 693 WP_339087448.1 hypothetical protein -
  WKR14_RS04725 (WKR14_04725) - 1015960..1016448 (+) 489 WP_339087450.1 Imm26 family immunity protein -
  WKR14_RS04730 (WKR14_04730) - 1016527..1016925 (-) 399 WP_319003754.1 helix-turn-helix domain-containing protein -
  WKR14_RS04735 (WKR14_04735) - 1017263..1018405 (+) 1143 WP_339087451.1 RHS repeat-associated core domain-containing protein -
  WKR14_RS04740 (WKR14_04740) - 1018407..1018829 (+) 423 WP_339087452.1 hypothetical protein -
  WKR14_RS04745 (WKR14_04745) - 1019292..1020284 (+) 993 WP_339087454.1 RHS repeat-associated core domain-containing protein -
  WKR14_RS04750 (WKR14_04750) - 1020287..1020847 (+) 561 WP_339087455.1 hypothetical protein -
  WKR14_RS21365 nucA/comI 1021483..1021794 (+) 312 WP_420884226.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  WKR14_RS04755 (WKR14_04755) comJ 1021797..1022279 (+) 483 WP_165564565.1 competence protein ComJ -
  WKR14_RS04760 (WKR14_04760) - 1022330..1023535 (+) 1206 WP_339087456.1 RHS repeat-associated core domain-containing protein -
  WKR14_RS04765 (WKR14_04765) - 1023569..1023931 (+) 363 WP_339087457.1 SMI1/KNR4 family protein -
  WKR14_RS04770 (WKR14_04770) - 1024103..1024540 (+) 438 WP_339087458.1 hypothetical protein -
  WKR14_RS04775 (WKR14_04775) - 1024774..1025079 (-) 306 WP_339087459.1 hypothetical protein -
  WKR14_RS04780 (WKR14_04780) - 1025142..1026292 (+) 1151 WP_115389451.1 IS3 family transposase -
  WKR14_RS04785 (WKR14_04785) - 1026380..1027255 (+) 876 WP_339087460.1 RHS repeat-associated core domain-containing protein -
  WKR14_RS04790 (WKR14_04790) - 1027245..1028021 (+) 777 WP_339087461.1 hypothetical protein -
  WKR14_RS04795 (WKR14_04795) - 1027965..1028945 (-) 981 WP_000082736.1 IS5-like element ISEc68 family transposase -
  WKR14_RS04800 (WKR14_04800) comJ 1029417..1029899 (+) 483 WP_165564565.1 competence protein ComJ -
  WKR14_RS04805 (WKR14_04805) - 1030046..1030378 (-) 333 WP_339087462.1 hypothetical protein -
  WKR14_RS04840 (WKR14_04840) - 1031847..1032896 (+) 1050 Protein_921 transposase -
  WKR14_RS04845 (WKR14_04845) - 1033163..1033663 (+) 501 WP_335918036.1 GNAT family N-acetyltransferase -
  WKR14_RS04850 (WKR14_04850) - 1033757..1034122 (+) 366 WP_339087463.1 hypothetical protein -
  WKR14_RS04855 (WKR14_04855) - 1035297..1036646 (-) 1350 WP_339087464.1 ATP-binding protein -
  WKR14_RS04860 (WKR14_04860) - 1036646..1037335 (-) 690 WP_208224177.1 response regulator transcription factor -
  WKR14_RS04865 (WKR14_04865) - 1037349..1037687 (-) 339 WP_025011880.1 PepSY domain-containing protein -
  WKR14_RS04870 (WKR14_04870) - 1037931..1038773 (+) 843 WP_339087466.1 choice-of-anchor H family protein -
  WKR14_RS04875 (WKR14_04875) tnpA 1039002..1039436 (+) 435 WP_208138538.1 IS200/IS605 family transposase -

Sequence

Protein


Download         Length: 103 a.a.        Molecular weight: 11274.52 Da        Isoelectric Point: 6.8685

>NTDB_id=962406 WKR14_RS21365 WP_420884226.1 1021483..1021794(+) (nucA/comI) [Shewanella chilikensis strain ST10]
MDVDSTVYPQTAGHIRDAISNGHPYIVTIDRSHAKSNRAKSLKGFKTQPNLDRDEWPMAMFQEGGDGASVRYIDPSDNRG
AGSSICHALSDLPDGTKVLFRVN

Nucleotide


Download         Length: 312 bp        

>NTDB_id=962406 WKR14_RS21365 WP_420884226.1 1021483..1021794(+) (nucA/comI) [Shewanella chilikensis strain ST10]
TTGGATGTCGATAGTACAGTCTATCCGCAGACCGCTGGCCATATTCGAGATGCGATCAGTAATGGTCATCCATATATAGT
TACGATAGATAGGTCTCATGCCAAATCCAACAGAGCAAAAAGTCTTAAAGGCTTTAAAACTCAGCCAAATCTCGACAGGG
ATGAATGGCCTATGGCTATGTTCCAGGAAGGGGGCGATGGCGCTAGTGTTAGGTATATAGATCCATCTGACAATCGGGGG
GCTGGTTCGAGCATCTGTCATGCATTATCCGACTTGCCAGATGGAACAAAAGTTCTTTTTAGGGTTAATTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(5-98)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.282

100

0.573