Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AABJ45_RS02615 | Genome accession | NZ_AP028611 |
| Coordinates | 521722..521871 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain Sep6 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 516722..526871
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABJ45_RS02580 (TKY121527_05130) | comA/nlmT | 516785..517510 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| AABJ45_RS02585 (TKY121527_05140) | comA/nlmT | 517455..518042 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| AABJ45_RS02590 (TKY121527_05150) | - | 518324..518527 (+) | 204 | WP_001093262.1 | bacteriocin class II family protein | - |
| AABJ45_RS02595 (TKY121527_05160) | - | 518845..519048 (+) | 204 | WP_000411016.1 | hypothetical protein | - |
| AABJ45_RS02600 | - | 520051..520855 (+) | 805 | Protein_511 | IS5 family transposase | - |
| AABJ45_RS02605 (TKY121527_05200) | blpM | 521005..521259 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| AABJ45_RS02610 (TKY121527_05210) | blpN | 521275..521478 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| AABJ45_RS02615 (TKY121527_05220) | cipB | 521722..521871 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| AABJ45_RS02620 | - | 521975..522094 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AABJ45_RS02625 | - | 522604..522797 (+) | 194 | Protein_516 | hypothetical protein | - |
| AABJ45_RS02630 (TKY121527_05240) | - | 522880..523263 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| AABJ45_RS02635 (TKY121527_05250) | - | 523315..524004 (+) | 690 | WP_000760527.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AABJ45_RS02640 (TKY121527_05260) | blpZ | 524046..524294 (+) | 249 | WP_126443090.1 | immunity protein BlpZ | - |
| AABJ45_RS02645 | - | 524324..524935 (+) | 612 | WP_000394045.1 | type II CAAX endopeptidase family protein | - |
| AABJ45_RS02650 (TKY121527_05270) | - | 525096..525890 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| AABJ45_RS02655 (TKY121527_05280) | trmB | 525887..526522 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=96175 AABJ45_RS02615 WP_001818346.1 521722..521871(+) (cipB) [Streptococcus pneumoniae strain Sep6]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=96175 AABJ45_RS02615 WP_001818346.1 521722..521871(+) (cipB) [Streptococcus pneumoniae strain Sep6]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |