Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   WKI52_RS07095 Genome accession   NZ_CP149646
Coordinates   1394552..1394671 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain MJ06     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1389552..1399671
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI52_RS07080 (WKI52_07080) - 1391164..1391847 (+) 684 WP_014416901.1 response regulator transcription factor -
  WKI52_RS07085 (WKI52_07085) - 1391834..1393261 (+) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  WKI52_RS07090 (WKI52_07090) rapC 1393420..1394568 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  WKI52_RS07095 (WKI52_07095) phrC 1394552..1394671 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  WKI52_RS07100 (WKI52_07100) - 1394821..1394916 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  WKI52_RS07105 (WKI52_07105) - 1395010..1396374 (-) 1365 WP_110085395.1 aspartate kinase -
  WKI52_RS07110 (WKI52_07110) ceuB 1396788..1397741 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  WKI52_RS07115 (WKI52_07115) - 1397731..1398678 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  WKI52_RS07120 (WKI52_07120) - 1398672..1399430 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=960199 WKI52_RS07095 WP_003156334.1 1394552..1394671(+) (phrC) [Bacillus velezensis strain MJ06]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=960199 WKI52_RS07095 WP_003156334.1 1394552..1394671(+) (phrC) [Bacillus velezensis strain MJ06]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718