Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHL52_RS17215 Genome accession   NZ_CP149576
Coordinates   3251076..3251243 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain DSM 10     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3246076..3256243
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL52_RS17185 mrpE 3246471..3246947 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHL52_RS17190 mrpF 3246947..3247231 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHL52_RS17195 mnhG 3247215..3247589 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHL52_RS17200 yuxO 3247628..3248008 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL52_RS17205 comA 3248027..3248671 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL52_RS17210 comP 3248752..3251061 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHL52_RS17215 comX 3251076..3251243 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL52_RS17220 comQ 3251231..3252130 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL52_RS17225 degQ 3252315..3252455 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL52_RS17230 - 3252677..3252802 (+) 126 WP_003228793.1 hypothetical protein -
  WHL52_RS17235 - 3252916..3253284 (+) 369 WP_003243784.1 hypothetical protein -
  WHL52_RS17240 pdeH 3253260..3254489 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL52_RS17245 pncB 3254626..3256098 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=959994 WHL52_RS17215 WP_003242801.1 3251076..3251243(-) (comX) [Bacillus subtilis strain DSM 10]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=959994 WHL52_RS17215 WP_003242801.1 3251076..3251243(-) (comX) [Bacillus subtilis strain DSM 10]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1