Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACIQTD_RS11385 Genome accession   NZ_CP173185
Coordinates   2329716..2330000 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain MGEL24009     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2324716..2335000
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIQTD_RS11355 - 2325156..2325533 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  ACIQTD_RS11360 - 2325738..2326604 (+) 867 WP_058218508.1 RluA family pseudouridine synthase -
  ACIQTD_RS11365 - 2326643..2327452 (-) 810 WP_014570791.1 metal ABC transporter permease -
  ACIQTD_RS11370 - 2327445..2328182 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ACIQTD_RS11375 - 2328359..2329201 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  ACIQTD_RS11380 - 2329198..2329635 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  ACIQTD_RS11385 comGG 2329716..2330000 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACIQTD_RS11390 comGF 2330039..2330485 (-) 447 WP_032948129.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACIQTD_RS11395 comGE 2330448..2330744 (-) 297 WP_017865157.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACIQTD_RS11400 comGD 2330716..2331147 (-) 432 WP_026138965.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACIQTD_RS11405 comGC 2331107..2331376 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  ACIQTD_RS11410 comGB 2331503..2332576 (-) 1074 WP_270250711.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACIQTD_RS11415 comGA 2332470..2333408 (-) 939 WP_270250640.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=957064 ACIQTD_RS11385 WP_017865155.1 2329716..2330000(-) (comGG) [Lactococcus lactis subsp. lactis strain MGEL24009]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=957064 ACIQTD_RS11385 WP_017865155.1 2329716..2330000(-) (comGG) [Lactococcus lactis subsp. lactis strain MGEL24009]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596