Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   QMM27_RS02380 Genome accession   NZ_AP025939
Coordinates   473439..473588 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain Utah_35B-24     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 468439..478588
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMM27_RS02355 (Utah35B_04530) blpC 468725..468853 (-) 129 WP_000358815.1 quorum-sensing system pheromone BlpC -
  QMM27_RS02360 (Utah35B_04540) - 468910..470271 (-) 1362 WP_001069072.1 bacteriocin secretion accessory protein -
  QMM27_RS02365 (Utah35B_04550) blpA 470282..472430 (-) 2149 Protein_465 peptide cleavage/export ABC transporter BlpA -
  QMM27_RS02370 (Utah35B_04570) blpM 472722..472976 (+) 255 WP_001093256.1 two-peptide bacteriocin subunit BlpM -
  QMM27_RS02375 (Utah35B_04580) blpN 472992..473195 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  QMM27_RS02380 (Utah35B_04590) cipB 473439..473588 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  QMM27_RS02385 - 473692..473811 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  QMM27_RS02390 (Utah35B_04600) - 474109..474273 (+) 165 WP_000727117.1 hypothetical protein -
  QMM27_RS02395 (Utah35B_04610) - 474335..474673 (+) 339 WP_088804618.1 immunity protein -
  QMM27_RS02400 (Utah35B_04630) - 475302..475685 (+) 384 WP_000877381.1 hypothetical protein -
  QMM27_RS02405 (Utah35B_04640) - 475737..476426 (+) 690 WP_000760520.1 CPBP family intramembrane glutamic endopeptidase -
  QMM27_RS02410 (Utah35B_04650) blpZ 476468..476716 (+) 249 WP_000276501.1 immunity protein BlpZ -
  QMM27_RS02415 - 476746..477357 (+) 612 WP_000394036.1 type II CAAX endopeptidase family protein -
  QMM27_RS02420 (Utah35B_04660) - 477518..478312 (+) 795 WP_000363002.1 phosphotransferase family protein -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=95419 QMM27_RS02380 WP_001809846.1 473439..473588(+) (cipB) [Streptococcus pneumoniae strain Utah_35B-24]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=95419 QMM27_RS02380 WP_001809846.1 473439..473588(+) (cipB) [Streptococcus pneumoniae strain Utah_35B-24]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment