Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACHGMI_RS14130 | Genome accession | NZ_CP172417 |
| Coordinates | 2584954..2585127 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain AKPS2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2579954..2590127
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACHGMI_RS14085 | comGE | 2580311..2580658 (+) | 348 | WP_017696195.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACHGMI_RS14090 | comGF | 2580684..2581067 (+) | 384 | WP_017696196.1 | ComG operon protein ComGF | Machinery gene |
| ACHGMI_RS14095 | comGG | 2581068..2581442 (+) | 375 | WP_017696197.1 | ComG operon protein ComGG | Machinery gene |
| ACHGMI_RS14100 | spoIITA | 2581513..2581692 (+) | 180 | WP_014480252.1 | YqzE family protein | - |
| ACHGMI_RS14105 | yqzG | 2581734..2582060 (-) | 327 | WP_026113671.1 | YqzG/YhdC family protein | - |
| ACHGMI_RS14110 | tapA | 2582331..2583086 (+) | 756 | WP_017696199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACHGMI_RS14115 | sipW | 2583070..2583642 (+) | 573 | WP_080031082.1 | signal peptidase I SipW | - |
| ACHGMI_RS14120 | tasA | 2583707..2584492 (+) | 786 | WP_017696201.1 | biofilm matrix protein TasA | - |
| ACHGMI_RS14125 | sinR | 2584585..2584920 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ACHGMI_RS14130 | sinI | 2584954..2585127 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| ACHGMI_RS14135 | yqhG | 2585310..2586104 (-) | 795 | WP_017696202.1 | YqhG family protein | - |
| ACHGMI_RS14140 | hepAA | 2586125..2587798 (-) | 1674 | WP_017696203.1 | DEAD/DEAH box helicase | - |
| ACHGMI_RS14145 | gcvT | 2588239..2589327 (+) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=953720 ACHGMI_RS14130 WP_003230187.1 2584954..2585127(-) (sinI) [Bacillus subtilis strain AKPS2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=953720 ACHGMI_RS14130 WP_003230187.1 2584954..2585127(-) (sinI) [Bacillus subtilis strain AKPS2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |