Detailed information    

insolico Bioinformatically predicted

Overview


Name   ceuB   Type   Machinery gene
Locus tag   WHP47_RS07170 Genome accession   NZ_CP148199
Coordinates   1355955..1356923 (+) Length   322 a.a.
NCBI ID   WP_002872671.1    Uniprot ID   Q0P8Q7
Organism   Campylobacter jejuni strain Z1323CCJ0072     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1322293..1355094 1355955..1356923 flank 861


Gene organization within MGE regions


Location: 1322293..1356923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHP47_RS06905 (WHP47_06905) - 1322293..1322982 (-) 690 WP_257070182.1 XRE family transcriptional regulator -
  WHP47_RS06910 (WHP47_06910) - 1323173..1323487 (-) 315 WP_002865557.1 hypothetical protein -
  WHP47_RS06915 (WHP47_06915) - 1323532..1323723 (+) 192 WP_338878052.1 hypothetical protein -
  WHP47_RS06920 (WHP47_06920) - 1323724..1325892 (+) 2169 WP_338909842.1 Mu transposase C-terminal domain-containing protein -
  WHP47_RS06925 (WHP47_06925) - 1325981..1326838 (+) 858 WP_002790751.1 AAA family ATPase -
  WHP47_RS06930 (WHP47_06930) - 1326835..1327026 (+) 192 WP_002791422.1 sigma factor-like helix-turn-helix DNA-binding protein -
  WHP47_RS06935 (WHP47_06935) - 1327023..1327208 (+) 186 WP_002824157.1 hypothetical protein -
  WHP47_RS06940 (WHP47_06940) - 1327264..1327695 (+) 432 WP_002865075.1 SA1788 family PVL leukocidin-associated protein -
  WHP47_RS06945 (WHP47_06945) - 1327769..1328107 (+) 339 WP_052777360.1 DUF4406 domain-containing protein -
  WHP47_RS06950 (WHP47_06950) - 1328303..1328788 (+) 486 WP_338909843.1 host-nuclease inhibitor Gam family protein -
  WHP47_RS06955 (WHP47_06955) - 1328887..1329126 (+) 240 WP_002875726.1 hypothetical protein -
  WHP47_RS06960 (WHP47_06960) - 1329267..1329905 (+) 639 WP_002875725.1 BRO family protein -
  WHP47_RS06965 (WHP47_06965) - 1329902..1330096 (+) 195 WP_002875724.1 hypothetical protein -
  WHP47_RS06970 (WHP47_06970) - 1330134..1330571 (+) 438 WP_070276125.1 hypothetical protein -
  WHP47_RS06975 (WHP47_06975) - 1330614..1330805 (+) 192 WP_002790256.1 hypothetical protein -
  WHP47_RS06980 (WHP47_06980) - 1330792..1331271 (+) 480 WP_043011864.1 phage virion morphogenesis protein -
  WHP47_RS06985 (WHP47_06985) - 1331410..1332543 (-) 1134 WP_002870187.1 phage minor head protein -
  WHP47_RS06990 (WHP47_06990) - 1332536..1333918 (-) 1383 WP_057980531.1 DUF935 family protein -
  WHP47_RS06995 (WHP47_06995) terL 1333915..1335441 (-) 1527 WP_057980530.1 phage terminase large subunit -
  WHP47_RS07000 (WHP47_07000) - 1335531..1335845 (-) 315 WP_002790261.1 phage holin family protein -
  WHP47_RS07005 (WHP47_07005) - 1335848..1335970 (-) 123 WP_002784494.1 hypothetical protein -
  WHP47_RS07010 (WHP47_07010) - 1335957..1336205 (-) 249 WP_002784496.1 hypothetical protein -
  WHP47_RS07015 (WHP47_07015) - 1336202..1336543 (-) 342 WP_002854893.1 hypothetical protein -
  WHP47_RS07020 (WHP47_07020) - 1336554..1336943 (-) 390 WP_052798388.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  WHP47_RS07025 (WHP47_07025) - 1336933..1337298 (-) 366 WP_002790266.1 hypothetical protein -
  WHP47_RS07030 (WHP47_07030) - 1337428..1337781 (-) 354 WP_002790896.1 hypothetical protein -
  WHP47_RS07035 (WHP47_07035) - 1337778..1338131 (-) 354 WP_338909847.1 hypothetical protein -
  WHP47_RS07040 (WHP47_07040) - 1338131..1339018 (-) 888 WP_002790002.1 Mu-like prophage major head subunit gpT family protein -
  WHP47_RS07045 (WHP47_07045) - 1339018..1340058 (-) 1041 WP_063674717.1 phage protease -
  WHP47_RS07050 (WHP47_07050) - 1340189..1340653 (+) 465 WP_002865847.1 DUF1804 family protein -
  WHP47_RS07055 (WHP47_07055) - 1340650..1341282 (+) 633 WP_002876443.1 phage baseplate assembly protein V -
  WHP47_RS07060 (WHP47_07060) - 1341291..1341482 (+) 192 WP_002795238.1 hypothetical protein -
  WHP47_RS07065 (WHP47_07065) - 1341479..1341769 (+) 291 WP_002795239.1 GPW/gp25 family protein -
  WHP47_RS07070 (WHP47_07070) - 1341766..1342932 (+) 1167 WP_338909848.1 baseplate J/gp47 family protein -
  WHP47_RS07075 (WHP47_07075) - 1343030..1343650 (+) 621 WP_338909850.1 phage tail protein I -
  WHP47_RS07080 (WHP47_07080) - 1343650..1344681 (+) 1032 WP_032584249.1 phage tail protein -
  WHP47_RS07085 (WHP47_07085) - 1344706..1345212 (+) 507 WP_338909852.1 hypothetical protein -
  WHP47_RS07090 (WHP47_07090) - 1345209..1345595 (+) 387 WP_338909853.1 DUF1353 domain-containing protein -
  WHP47_RS07095 (WHP47_07095) - 1345592..1346599 (+) 1008 WP_338909854.1 hypothetical protein -
  WHP47_RS07100 (WHP47_07100) - 1346618..1347808 (+) 1191 WP_265604847.1 phage tail sheath family protein -
  WHP47_RS07105 (WHP47_07105) - 1347931..1348446 (+) 516 WP_002865794.1 phage major tail tube protein -
  WHP47_RS07110 (WHP47_07110) - 1348457..1348693 (+) 237 WP_057030919.1 phage tail assembly protein -
  WHP47_RS07115 (WHP47_07115) - 1348801..1349031 (-) 231 WP_002789978.1 hypothetical protein -
  WHP47_RS07120 (WHP47_07120) - 1349061..1351025 (+) 1965 WP_265604370.1 phage tail tape measure protein -
  WHP47_RS07125 (WHP47_07125) - 1351027..1351401 (+) 375 WP_002923429.1 phage tail protein -
  WHP47_RS07130 (WHP47_07130) - 1351394..1351585 (+) 192 WP_002789964.1 tail protein X -
  WHP47_RS07135 (WHP47_07135) - 1351579..1352547 (+) 969 WP_002865687.1 phage tail protein -
  WHP47_RS07140 (WHP47_07140) - 1352649..1353464 (+) 816 WP_265604846.1 DNA adenine methylase -
  WHP47_RS07145 (WHP47_07145) - 1353494..1353781 (-) 288 WP_002865266.1 hypothetical protein -
  WHP47_RS07150 (WHP47_07150) - 1353861..1354055 (-) 195 WP_002843339.1 hypothetical protein -
  WHP47_RS07155 (WHP47_07155) - 1354065..1354385 (-) 321 WP_002865000.1 hypothetical protein -
  WHP47_RS07160 (WHP47_07160) - 1354465..1355094 (-) 630 WP_126417986.1 LexA family transcriptional regulator -
  WHP47_RS07165 (WHP47_07165) - 1355273..1355869 (+) 597 Protein_1392 phospholipase A -
  WHP47_RS07170 (WHP47_07170) ceuB 1355955..1356923 (+) 969 WP_002872671.1 ABC transporter permease Machinery gene

Sequence


Protein


Download         Length: 322 a.a.        Molecular weight: 35469.40 Da        Isoelectric Point: 9.6678

>NTDB_id=952614 WHP47_RS07170 WP_002872671.1 1355955..1356923(+) (ceuB) [Campylobacter jejuni strain Z1323CCJ0072]
MFFKHILSLKVLIALLLFFGMISLFIGVISINVKDILNLNSTQLEIITLTRIPRLIAILLTGMSLSICGLIMQQLTQNKF
VSPTTAGTMDCAKFGILISLIFFTGASFFTQAIIASIFALLGSFIFIQILRKIKLKDVIFVPLIGLMFGGIISAITTFFA
YALNYIQNIQGWLQGSMANVMQGNYELLYISLPLFILAYFLAHKITIVGMGEDIALNLGISYNGILFLGLMIVSIITSLV
IVSVGIIPFLGLIIPNLVALYLGDNLRKNLIYIALCGALFLLVCDIISRLVIFPFEMPLSITTGVLGSLIFIFLLLKRKV
YA

Nucleotide


Download         Length: 969 bp        

>NTDB_id=952614 WHP47_RS07170 WP_002872671.1 1355955..1356923(+) (ceuB) [Campylobacter jejuni strain Z1323CCJ0072]
TTGTTTTTTAAGCATATATTGAGTTTAAAAGTGCTTATAGCTTTACTTTTATTCTTTGGAATGATAAGTTTATTTATAGG
AGTTATCAGTATCAATGTAAAAGATATTCTTAATCTTAACTCCACTCAACTAGAAATCATAACTCTCACAAGAATTCCTA
GACTTATAGCAATTTTACTCACAGGAATGAGTCTTAGTATATGTGGGCTTATCATGCAACAACTCACGCAAAATAAATTC
GTTTCCCCAACTACAGCAGGGACCATGGATTGTGCTAAATTTGGCATACTTATTTCTTTAATATTTTTTACTGGAGCGTC
TTTTTTCACTCAAGCTATCATTGCTTCTATATTTGCACTTTTGGGTTCTTTTATATTTATCCAAATTTTAAGAAAAATCA
AACTCAAAGATGTGATTTTTGTACCTTTGATAGGCTTGATGTTTGGAGGTATTATTAGTGCTATAACCACTTTTTTTGCC
TATGCTTTAAATTATATACAAAATATCCAAGGTTGGCTACAAGGCAGTATGGCAAATGTTATGCAGGGAAATTATGAATT
GCTCTACATTTCTTTACCACTTTTTATACTTGCTTATTTTTTAGCTCATAAAATCACCATAGTTGGCATGGGTGAAGATA
TAGCTTTAAATCTTGGAATTTCTTATAATGGTATATTATTTTTAGGCTTAATGATTGTAAGCATTATCACTAGCTTAGTG
ATTGTAAGCGTTGGGATTATCCCTTTTTTAGGGCTAATTATCCCAAATTTAGTAGCTCTTTATCTAGGTGATAATCTTAG
AAAAAATCTTATCTATATAGCACTTTGTGGAGCTTTGTTTTTACTTGTTTGCGATATCATTTCAAGACTTGTTATCTTTC
CTTTTGAAATGCCTTTAAGTATCACTACAGGTGTTTTAGGGTCTTTAATCTTTATCTTTCTTTTACTAAAAAGGAAAGTT
TATGCGTAA

Domains


Predicted by InterproScan.

(15-317)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q0P8Q7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ceuB Campylobacter jejuni subsp. jejuni 81-176

99.068

100

0.991