Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | QML87_RS02375 | Genome accession | NZ_AP025936 |
| Coordinates | 473652..473801 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700617 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 468652..478801
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QML87_RS02350 (PC0607_04540) | blpC | 468938..469066 (-) | 129 | WP_000358815.1 | quorum-sensing system pheromone BlpC | - |
| QML87_RS02355 (PC0607_04550) | - | 469123..470484 (-) | 1362 | WP_001069072.1 | bacteriocin secretion accessory protein | - |
| QML87_RS02360 (PC0607_04560) | blpA | 470495..472643 (-) | 2149 | Protein_464 | peptide cleavage/export ABC transporter BlpA | - |
| QML87_RS02365 (PC0607_04580) | blpM | 472935..473189 (+) | 255 | WP_001093256.1 | two-peptide bacteriocin subunit BlpM | - |
| QML87_RS02370 (PC0607_04590) | blpN | 473205..473408 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| QML87_RS02375 (PC0607_04600) | cipB | 473652..473801 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| QML87_RS02380 | - | 473905..474024 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| QML87_RS02385 (PC0607_04610) | - | 474322..474486 (+) | 165 | WP_000727117.1 | hypothetical protein | - |
| QML87_RS02390 | - | 474548..474886 (+) | 339 | WP_088804618.1 | immunity protein | - |
| QML87_RS02395 (PC0607_04640) | - | 475515..475898 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| QML87_RS02400 (PC0607_04650) | - | 475950..476639 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| QML87_RS02405 (PC0607_04660) | blpZ | 476681..476929 (+) | 249 | WP_000276501.1 | immunity protein BlpZ | - |
| QML87_RS02410 | - | 476959..477570 (+) | 612 | WP_000394036.1 | type II CAAX endopeptidase family protein | - |
| QML87_RS02415 (PC0607_04670) | - | 477731..478525 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=95188 QML87_RS02375 WP_001809846.1 473652..473801(+) (cipB) [Streptococcus pneumoniae strain PZ900700617]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=95188 QML87_RS02375 WP_001809846.1 473652..473801(+) (cipB) [Streptococcus pneumoniae strain PZ900700617]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |