Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   WHO18_RS13960 Genome accession   NZ_CP148128
Coordinates   2651974..2652384 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis isolate FELIX_MS620     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647340..2698830 2651974..2652384 within 0


Gene organization within MGE regions


Location: 2647340..2698830
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO18_RS13935 yqeF 2647507..2648238 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  WHO18_RS13940 cwlH 2648490..2649242 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  WHO18_RS13945 yqeD 2649429..2650055 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  WHO18_RS13950 gnd 2650074..2650967 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  WHO18_RS13955 yqeB 2651219..2651941 (+) 723 WP_010886572.1 hypothetical protein -
  WHO18_RS13960 nucA/comI 2651974..2652384 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  WHO18_RS13965 - 2652580..2652927 (+) 348 Protein_2704 sigma-70 family RNA polymerase sigma factor -
  WHO18_RS13970 spoIVCA 2652958..2654418 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  WHO18_RS13975 - 2654376..2654554 (-) 179 Protein_2706 hypothetical protein -
  WHO18_RS13980 arsC 2654909..2655328 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  WHO18_RS13985 acr3 2655340..2656380 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  WHO18_RS13990 yqcK 2656403..2656843 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  WHO18_RS13995 arsR 2656904..2657221 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  WHO18_RS14000 yqcI 2657593..2658357 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  WHO18_RS14005 rapE 2658800..2659927 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  WHO18_RS14010 phrE 2659917..2660051 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  WHO18_RS14015 - 2660161..2660319 (+) 159 WP_003245945.1 hypothetical protein -
  WHO18_RS14020 yqcG 2660689..2662284 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  WHO18_RS14025 yqcF 2662299..2662877 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  WHO18_RS14030 - 2662995..2663141 (+) 147 WP_009967791.1 hypothetical protein -
  WHO18_RS14035 - 2663138..2663500 (-) 363 WP_003229947.1 hypothetical protein -
  WHO18_RS14040 - 2663516..2663995 (-) 480 WP_004399085.1 hypothetical protein -
  WHO18_RS14045 cwlA 2664160..2664978 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  WHO18_RS14050 yqxH 2665023..2665445 (-) 423 WP_003246208.1 holin family protein -
  WHO18_RS14055 yqxG 2665490..2666383 (-) 894 WP_003246010.1 hypothetical protein -
  WHO18_RS14060 yqcE 2666471..2666635 (-) 165 WP_003229944.1 XkdX family protein -
  WHO18_RS14065 yqcD 2666632..2666967 (-) 336 WP_009967793.1 XkdW family protein -
  WHO18_RS14070 yqcC 2666977..2668077 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  WHO18_RS14075 - 2668080..2668352 (-) 273 WP_003229942.1 hypothetical protein -
  WHO18_RS14080 yqcA 2668349..2668927 (-) 579 WP_003229941.1 YmfQ family protein -
  WHO18_RS14085 yqbT 2668911..2669957 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  WHO18_RS14090 yqbS 2669950..2670375 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  WHO18_RS14095 yqbR 2670388..2670651 (-) 264 WP_003229938.1 DUF2577 family protein -
  WHO18_RS14100 yqbQ 2670648..2671628 (-) 981 WP_004398524.1 hypothetical protein -
  WHO18_RS14105 yqbP 2671641..2672300 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  WHO18_RS14110 yqbO 2672293..2677050 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  WHO18_RS14115 - 2677053..2677190 (-) 138 WP_003229934.1 hypothetical protein -
  WHO18_RS14120 - 2677232..2677681 (-) 450 WP_003229933.1 phage portal protein -
  WHO18_RS14125 txpA 2677827..2678006 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  WHO18_RS14130 bsrH 2678386..2678475 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  WHO18_RS14135 yqbM 2678729..2679172 (-) 444 WP_003229930.1 phage tail tube protein -
  WHO18_RS14140 yqbK 2679175..2680575 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  WHO18_RS14145 - 2680576..2680767 (-) 192 WP_010886574.1 hypothetical protein -
  WHO18_RS14150 yqbJ 2680764..2681201 (-) 438 WP_003229927.1 DUF6838 family protein -
  WHO18_RS14155 yqbI 2681214..2681717 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  WHO18_RS14160 yqbH 2681714..2682076 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  WHO18_RS14165 yqbG 2682073..2682468 (-) 396 WP_004398566.1 DUF3199 family protein -
  WHO18_RS14170 yqbF 2682472..2682783 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  WHO18_RS14175 yqbE 2682794..2683729 (-) 936 WP_003229922.1 phage major capsid protein -
  WHO18_RS14180 yqbD 2683748..2684716 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  WHO18_RS14185 - 2684749..2685402 (-) 654 WP_003229920.1 hypothetical protein -
  WHO18_RS14190 yqbB 2685443..2686360 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  WHO18_RS14195 yqbA 2686357..2687889 (-) 1533 WP_004398894.1 phage portal protein -
  WHO18_RS14200 yqaT 2687893..2689188 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  WHO18_RS14205 terS 2689181..2689900 (-) 720 WP_003229916.1 phage terminase small subunit -
  WHO18_RS14210 - 2689968..2690432 (-) 465 WP_004398685.1 hypothetical protein -
  WHO18_RS14215 yqaQ 2690576..2691031 (-) 456 WP_004398775.1 hypothetical protein -
  WHO18_RS14220 - 2691229..2692158 (+) 930 WP_003229913.1 hypothetical protein -
  WHO18_RS14225 yqaO 2692232..2692438 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  WHO18_RS14230 yqaN 2692520..2692948 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  WHO18_RS14235 - 2693044..2693193 (-) 150 WP_003229910.1 hypothetical protein -
  WHO18_RS14240 sknM 2693184..2694125 (-) 942 WP_075058863.1 ATP-binding protein -
  WHO18_RS14245 yqaL 2694007..2694684 (-) 678 WP_010886575.1 DnaD domain protein -
  WHO18_RS14250 yqaK 2694760..2695614 (-) 855 WP_003229907.1 recombinase RecT -
  WHO18_RS14255 yqaJ 2695617..2696576 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  WHO18_RS14260 - 2696682..2696876 (-) 195 WP_003229905.1 hypothetical protein -
  WHO18_RS14265 - 2696836..2697009 (-) 174 WP_119123069.1 hypothetical protein -
  WHO18_RS14270 sknH 2697006..2697263 (-) 258 WP_003245994.1 YqaH family protein -
  WHO18_RS14275 yqaG 2697260..2697829 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  WHO18_RS14280 - 2697903..2698043 (-) 141 WP_003229902.1 hypothetical protein -
  WHO18_RS14285 yqaF 2698073..2698303 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  WHO18_RS14290 sknR 2698480..2698830 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=951459 WHO18_RS13960 WP_009967785.1 2651974..2652384(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS620]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=951459 WHO18_RS13960 WP_009967785.1 2651974..2652384(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS620]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529