Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   WHO22_RS13955 Genome accession   NZ_CP148122
Coordinates   2651899..2652309 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis isolate FELIX_MS513     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647265..2698755 2651899..2652309 within 0


Gene organization within MGE regions


Location: 2647265..2698755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO22_RS13930 yqeF 2647432..2648163 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  WHO22_RS13935 cwlH 2648415..2649167 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  WHO22_RS13940 yqeD 2649354..2649980 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  WHO22_RS13945 gnd 2649999..2650892 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  WHO22_RS13950 yqeB 2651144..2651866 (+) 723 WP_010886572.1 hypothetical protein -
  WHO22_RS13955 nucA/comI 2651899..2652309 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  WHO22_RS13960 - 2652505..2652852 (+) 348 Protein_2703 sigma-70 family RNA polymerase sigma factor -
  WHO22_RS13965 spoIVCA 2652883..2654343 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  WHO22_RS13970 - 2654301..2654479 (-) 179 Protein_2705 hypothetical protein -
  WHO22_RS13975 arsC 2654834..2655253 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  WHO22_RS13980 acr3 2655265..2656305 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  WHO22_RS13985 yqcK 2656328..2656768 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  WHO22_RS13990 arsR 2656829..2657146 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  WHO22_RS13995 yqcI 2657518..2658282 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  WHO22_RS14000 rapE 2658725..2659852 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  WHO22_RS14005 phrE 2659842..2659976 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  WHO22_RS14010 - 2660086..2660244 (+) 159 WP_003245945.1 hypothetical protein -
  WHO22_RS14015 yqcG 2660614..2662209 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  WHO22_RS14020 yqcF 2662224..2662802 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  WHO22_RS14025 - 2662920..2663066 (+) 147 WP_009967791.1 hypothetical protein -
  WHO22_RS14030 - 2663063..2663425 (-) 363 WP_003229947.1 hypothetical protein -
  WHO22_RS14035 - 2663441..2663920 (-) 480 WP_004399085.1 hypothetical protein -
  WHO22_RS14040 cwlA 2664085..2664903 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  WHO22_RS14045 yqxH 2664948..2665370 (-) 423 WP_003246208.1 holin family protein -
  WHO22_RS14050 yqxG 2665415..2666308 (-) 894 WP_003246010.1 hypothetical protein -
  WHO22_RS14055 yqcE 2666396..2666560 (-) 165 WP_003229944.1 XkdX family protein -
  WHO22_RS14060 yqcD 2666557..2666892 (-) 336 WP_009967793.1 XkdW family protein -
  WHO22_RS14065 yqcC 2666902..2668002 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  WHO22_RS14070 - 2668005..2668277 (-) 273 WP_003229942.1 hypothetical protein -
  WHO22_RS14075 yqcA 2668274..2668852 (-) 579 WP_003229941.1 YmfQ family protein -
  WHO22_RS14080 yqbT 2668836..2669882 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  WHO22_RS14085 yqbS 2669875..2670300 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  WHO22_RS14090 yqbR 2670313..2670576 (-) 264 WP_003229938.1 DUF2577 family protein -
  WHO22_RS14095 yqbQ 2670573..2671553 (-) 981 WP_004398524.1 hypothetical protein -
  WHO22_RS14100 yqbP 2671566..2672225 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  WHO22_RS14105 yqbO 2672218..2676975 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  WHO22_RS14110 - 2676978..2677115 (-) 138 WP_003229934.1 hypothetical protein -
  WHO22_RS14115 - 2677157..2677606 (-) 450 WP_003229933.1 phage portal protein -
  WHO22_RS14120 txpA 2677752..2677931 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  WHO22_RS14125 bsrH 2678311..2678400 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  WHO22_RS14130 yqbM 2678654..2679097 (-) 444 WP_003229930.1 phage tail tube protein -
  WHO22_RS14135 yqbK 2679100..2680500 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  WHO22_RS14140 - 2680501..2680692 (-) 192 WP_010886574.1 hypothetical protein -
  WHO22_RS14145 yqbJ 2680689..2681126 (-) 438 WP_003229927.1 DUF6838 family protein -
  WHO22_RS14150 yqbI 2681139..2681642 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  WHO22_RS14155 yqbH 2681639..2682001 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  WHO22_RS14160 yqbG 2681998..2682393 (-) 396 WP_004398566.1 DUF3199 family protein -
  WHO22_RS14165 yqbF 2682397..2682708 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  WHO22_RS14170 yqbE 2682719..2683654 (-) 936 WP_003229922.1 phage major capsid protein -
  WHO22_RS14175 yqbD 2683673..2684641 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  WHO22_RS14180 - 2684674..2685327 (-) 654 WP_003229920.1 hypothetical protein -
  WHO22_RS14185 yqbB 2685368..2686285 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  WHO22_RS14190 yqbA 2686282..2687814 (-) 1533 WP_004398894.1 phage portal protein -
  WHO22_RS14195 yqaT 2687818..2689113 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  WHO22_RS14200 terS 2689106..2689825 (-) 720 WP_003229916.1 phage terminase small subunit -
  WHO22_RS14205 - 2689893..2690357 (-) 465 WP_004398685.1 hypothetical protein -
  WHO22_RS14210 yqaQ 2690501..2690956 (-) 456 WP_004398775.1 hypothetical protein -
  WHO22_RS14215 - 2691154..2692083 (+) 930 WP_003229913.1 hypothetical protein -
  WHO22_RS14220 yqaO 2692157..2692363 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  WHO22_RS14225 yqaN 2692445..2692873 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  WHO22_RS14230 - 2692969..2693118 (-) 150 WP_003229910.1 hypothetical protein -
  WHO22_RS14235 sknM 2693109..2694050 (-) 942 WP_075058863.1 ATP-binding protein -
  WHO22_RS14240 yqaL 2693932..2694609 (-) 678 WP_010886575.1 DnaD domain protein -
  WHO22_RS14245 yqaK 2694685..2695539 (-) 855 WP_003229907.1 recombinase RecT -
  WHO22_RS14250 yqaJ 2695542..2696501 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  WHO22_RS14255 - 2696607..2696801 (-) 195 WP_003229905.1 hypothetical protein -
  WHO22_RS14260 - 2696761..2696934 (-) 174 WP_119123069.1 hypothetical protein -
  WHO22_RS14265 sknH 2696931..2697188 (-) 258 WP_003245994.1 YqaH family protein -
  WHO22_RS14270 yqaG 2697185..2697754 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  WHO22_RS14275 - 2697828..2697968 (-) 141 WP_003229902.1 hypothetical protein -
  WHO22_RS14280 yqaF 2697998..2698228 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  WHO22_RS14285 sknR 2698405..2698755 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=951241 WHO22_RS13955 WP_009967785.1 2651899..2652309(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS513]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=951241 WHO22_RS13955 WP_009967785.1 2651899..2652309(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS513]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529