Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHO64_RS17220 Genome accession   NZ_CP148117
Coordinates   3256386..3256526 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS509     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251386..3261526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO64_RS17195 yuxO 3251699..3252079 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO64_RS17200 comA 3252098..3252742 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO64_RS17205 comP 3252823..3255132 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO64_RS17210 comX 3255147..3255314 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO64_RS17215 comQ 3255302..3256201 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO64_RS17220 degQ 3256386..3256526 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO64_RS17225 - 3256748..3256873 (+) 126 WP_003228793.1 hypothetical protein -
  WHO64_RS17230 - 3256987..3257355 (+) 369 WP_003243784.1 hypothetical protein -
  WHO64_RS17235 pdeH 3257331..3258560 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO64_RS17240 pncB 3258697..3260169 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHO64_RS17245 pncA 3260185..3260736 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHO64_RS17250 yueI 3260833..3261231 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=951060 WHO64_RS17220 WP_003220708.1 3256386..3256526(-) (degQ) [Bacillus subtilis isolate FELIX_MS509]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=951060 WHO64_RS17220 WP_003220708.1 3256386..3256526(-) (degQ) [Bacillus subtilis isolate FELIX_MS509]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1