Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WHO64_RS13345 Genome accession   NZ_CP148117
Coordinates   2551737..2551910 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS509     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2546737..2556910
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO64_RS13330 gcvT 2547536..2548624 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHO64_RS13335 yqhH 2549066..2550739 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHO64_RS13340 yqhG 2550760..2551554 (+) 795 WP_003230200.1 YqhG family protein -
  WHO64_RS13345 sinI 2551737..2551910 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO64_RS13350 sinR 2551944..2552279 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO64_RS13355 tasA 2552372..2553157 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO64_RS13360 sipW 2553221..2553793 (-) 573 WP_003246088.1 signal peptidase I -
  WHO64_RS13365 tapA 2553777..2554538 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO64_RS13370 yqzG 2554810..2555136 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO64_RS13375 spoIIT 2555178..2555357 (-) 180 WP_003230176.1 YqzE family protein -
  WHO64_RS13380 comGG 2555428..2555802 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO64_RS13385 comGF 2555803..2556186 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO64_RS13390 comGE 2556212..2556559 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=951034 WHO64_RS13345 WP_003230187.1 2551737..2551910(+) (sinI) [Bacillus subtilis isolate FELIX_MS509]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=951034 WHO64_RS13345 WP_003230187.1 2551737..2551910(+) (sinI) [Bacillus subtilis isolate FELIX_MS509]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1