Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   WHO62_RS13935 Genome accession   NZ_CP148114
Coordinates   2651392..2651802 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis isolate FELIX_MS506     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2646758..2698248 2651392..2651802 within 0


Gene organization within MGE regions


Location: 2646758..2698248
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO62_RS13910 yqeF 2646925..2647656 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  WHO62_RS13915 cwlH 2647908..2648660 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  WHO62_RS13920 yqeD 2648847..2649473 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  WHO62_RS13925 gnd 2649492..2650385 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  WHO62_RS13930 yqeB 2650637..2651359 (+) 723 WP_010886572.1 hypothetical protein -
  WHO62_RS13935 nucA/comI 2651392..2651802 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  WHO62_RS13940 - 2651998..2652345 (+) 348 Protein_2699 sigma-70 family RNA polymerase sigma factor -
  WHO62_RS13945 spoIVCA 2652376..2653836 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  WHO62_RS13950 - 2653794..2653972 (-) 179 Protein_2701 hypothetical protein -
  WHO62_RS13955 arsC 2654327..2654746 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  WHO62_RS13960 acr3 2654758..2655798 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  WHO62_RS13965 yqcK 2655821..2656261 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  WHO62_RS13970 arsR 2656322..2656639 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  WHO62_RS13975 yqcI 2657011..2657775 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  WHO62_RS13980 rapE 2658218..2659345 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  WHO62_RS13985 phrE 2659335..2659469 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  WHO62_RS13990 - 2659579..2659737 (+) 159 WP_003245945.1 hypothetical protein -
  WHO62_RS13995 yqcG 2660107..2661702 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  WHO62_RS14000 yqcF 2661717..2662295 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  WHO62_RS14005 - 2662413..2662559 (+) 147 WP_009967791.1 hypothetical protein -
  WHO62_RS14010 - 2662556..2662918 (-) 363 WP_003229947.1 hypothetical protein -
  WHO62_RS14015 - 2662934..2663413 (-) 480 WP_004399085.1 hypothetical protein -
  WHO62_RS14020 cwlA 2663578..2664396 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  WHO62_RS14025 yqxH 2664441..2664863 (-) 423 WP_003246208.1 holin family protein -
  WHO62_RS14030 yqxG 2664908..2665801 (-) 894 WP_003246010.1 hypothetical protein -
  WHO62_RS14035 yqcE 2665889..2666053 (-) 165 WP_003229944.1 XkdX family protein -
  WHO62_RS14040 yqcD 2666050..2666385 (-) 336 WP_009967793.1 XkdW family protein -
  WHO62_RS14045 yqcC 2666395..2667495 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  WHO62_RS14050 - 2667498..2667770 (-) 273 WP_003229942.1 hypothetical protein -
  WHO62_RS14055 yqcA 2667767..2668345 (-) 579 WP_003229941.1 YmfQ family protein -
  WHO62_RS14060 yqbT 2668329..2669375 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  WHO62_RS14065 yqbS 2669368..2669793 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  WHO62_RS14070 yqbR 2669806..2670069 (-) 264 WP_003229938.1 DUF2577 family protein -
  WHO62_RS14075 yqbQ 2670066..2671046 (-) 981 WP_004398524.1 hypothetical protein -
  WHO62_RS14080 yqbP 2671059..2671718 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  WHO62_RS14085 yqbO 2671711..2676468 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  WHO62_RS14090 - 2676471..2676608 (-) 138 WP_003229934.1 hypothetical protein -
  WHO62_RS14095 - 2676650..2677099 (-) 450 WP_003229933.1 phage portal protein -
  WHO62_RS14100 txpA 2677245..2677424 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  WHO62_RS14105 bsrH 2677804..2677893 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  WHO62_RS14110 yqbM 2678147..2678590 (-) 444 WP_003229930.1 phage tail tube protein -
  WHO62_RS14115 yqbK 2678593..2679993 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  WHO62_RS14120 - 2679994..2680185 (-) 192 WP_010886574.1 hypothetical protein -
  WHO62_RS14125 yqbJ 2680182..2680619 (-) 438 WP_003229927.1 DUF6838 family protein -
  WHO62_RS14130 yqbI 2680632..2681135 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  WHO62_RS14135 yqbH 2681132..2681494 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  WHO62_RS14140 yqbG 2681491..2681886 (-) 396 WP_004398566.1 DUF3199 family protein -
  WHO62_RS14145 yqbF 2681890..2682201 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  WHO62_RS14150 yqbE 2682212..2683147 (-) 936 WP_003229922.1 phage major capsid protein -
  WHO62_RS14155 yqbD 2683166..2684134 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  WHO62_RS14160 - 2684167..2684820 (-) 654 WP_003229920.1 hypothetical protein -
  WHO62_RS14165 yqbB 2684861..2685778 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  WHO62_RS14170 yqbA 2685775..2687307 (-) 1533 WP_004398894.1 phage portal protein -
  WHO62_RS14175 yqaT 2687311..2688606 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  WHO62_RS14180 terS 2688599..2689318 (-) 720 WP_003229916.1 phage terminase small subunit -
  WHO62_RS14185 - 2689386..2689850 (-) 465 WP_004398685.1 hypothetical protein -
  WHO62_RS14190 yqaQ 2689994..2690449 (-) 456 WP_004398775.1 hypothetical protein -
  WHO62_RS14195 - 2690647..2691576 (+) 930 WP_003229913.1 hypothetical protein -
  WHO62_RS14200 yqaO 2691650..2691856 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  WHO62_RS14205 yqaN 2691938..2692366 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  WHO62_RS14210 - 2692462..2692611 (-) 150 WP_003229910.1 hypothetical protein -
  WHO62_RS14215 sknM 2692602..2693543 (-) 942 WP_075058863.1 ATP-binding protein -
  WHO62_RS14220 yqaL 2693425..2694102 (-) 678 WP_010886575.1 DnaD domain protein -
  WHO62_RS14225 yqaK 2694178..2695032 (-) 855 WP_003229907.1 recombinase RecT -
  WHO62_RS14230 yqaJ 2695035..2695994 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  WHO62_RS14235 - 2696100..2696294 (-) 195 WP_003229905.1 hypothetical protein -
  WHO62_RS14240 - 2696254..2696427 (-) 174 WP_119123069.1 hypothetical protein -
  WHO62_RS14245 sknH 2696424..2696681 (-) 258 WP_003245994.1 YqaH family protein -
  WHO62_RS14250 yqaG 2696678..2697247 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  WHO62_RS14255 - 2697321..2697461 (-) 141 WP_003229902.1 hypothetical protein -
  WHO62_RS14260 yqaF 2697491..2697721 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  WHO62_RS14265 sknR 2697898..2698248 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=950939 WHO62_RS13935 WP_009967785.1 2651392..2651802(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS506]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=950939 WHO62_RS13935 WP_009967785.1 2651392..2651802(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS506]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529