Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WHO62_RS13345 Genome accession   NZ_CP148114
Coordinates   2551450..2551623 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS506     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2546450..2556623
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO62_RS13330 gcvT 2547249..2548337 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHO62_RS13335 yqhH 2548779..2550452 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHO62_RS13340 yqhG 2550473..2551267 (+) 795 WP_003230200.1 YqhG family protein -
  WHO62_RS13345 sinI 2551450..2551623 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO62_RS13350 sinR 2551657..2551992 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO62_RS13355 tasA 2552085..2552870 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO62_RS13360 sipW 2552934..2553506 (-) 573 WP_003246088.1 signal peptidase I -
  WHO62_RS13365 tapA 2553490..2554251 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO62_RS13370 yqzG 2554523..2554849 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO62_RS13375 spoIIT 2554891..2555070 (-) 180 WP_003230176.1 YqzE family protein -
  WHO62_RS13380 comGG 2555141..2555515 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO62_RS13385 comGF 2555516..2555899 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO62_RS13390 comGE 2555925..2556272 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=950926 WHO62_RS13345 WP_003230187.1 2551450..2551623(+) (sinI) [Bacillus subtilis isolate FELIX_MS506]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=950926 WHO62_RS13345 WP_003230187.1 2551450..2551623(+) (sinI) [Bacillus subtilis isolate FELIX_MS506]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1