Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHO32_RS17235 Genome accession   NZ_CP148112
Coordinates   3255443..3255610 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate FELIX_MS504     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3250443..3260610
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO32_RS17205 mrpE 3250838..3251314 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHO32_RS17210 mrpF 3251314..3251598 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHO32_RS17215 mnhG 3251582..3251956 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHO32_RS17220 yuxO 3251995..3252375 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO32_RS17225 comA 3252394..3253038 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO32_RS17230 comP 3253119..3255428 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO32_RS17235 comX 3255443..3255610 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO32_RS17240 comQ 3255598..3256497 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO32_RS17245 degQ 3256682..3256822 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO32_RS17250 - 3257044..3257169 (+) 126 WP_003228793.1 hypothetical protein -
  WHO32_RS17255 - 3257283..3257651 (+) 369 WP_003243784.1 hypothetical protein -
  WHO32_RS17260 pdeH 3257627..3258856 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO32_RS17265 pncB 3258993..3260465 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=950864 WHO32_RS17235 WP_003242801.1 3255443..3255610(-) (comX) [Bacillus subtilis isolate FELIX_MS504]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=950864 WHO32_RS17235 WP_003242801.1 3255443..3255610(-) (comX) [Bacillus subtilis isolate FELIX_MS504]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1