Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHO49_RS17210 Genome accession   NZ_CP148110
Coordinates   3255085..3255252 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate FELIX_MS499     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3250085..3260252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO49_RS17180 mrpE 3250480..3250956 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHO49_RS17185 mrpF 3250956..3251240 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHO49_RS17190 mnhG 3251224..3251598 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHO49_RS17195 yuxO 3251637..3252017 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO49_RS17200 comA 3252036..3252680 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO49_RS17205 comP 3252761..3255070 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO49_RS17210 comX 3255085..3255252 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO49_RS17215 comQ 3255240..3256139 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO49_RS17220 degQ 3256324..3256464 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO49_RS17225 - 3256686..3256811 (+) 126 WP_003228793.1 hypothetical protein -
  WHO49_RS17230 - 3256925..3257293 (+) 369 WP_003243784.1 hypothetical protein -
  WHO49_RS17235 pdeH 3257269..3258498 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO49_RS17240 pncB 3258635..3260107 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=950778 WHO49_RS17210 WP_003242801.1 3255085..3255252(-) (comX) [Bacillus subtilis isolate FELIX_MS499]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=950778 WHO49_RS17210 WP_003242801.1 3255085..3255252(-) (comX) [Bacillus subtilis isolate FELIX_MS499]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1