Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   WHO49_RS13935 Genome accession   NZ_CP148110
Coordinates   2651617..2652027 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis isolate FELIX_MS499     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2646983..2698473 2651617..2652027 within 0


Gene organization within MGE regions


Location: 2646983..2698473
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO49_RS13910 yqeF 2647150..2647881 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  WHO49_RS13915 cwlH 2648133..2648885 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  WHO49_RS13920 yqeD 2649072..2649698 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  WHO49_RS13925 gnd 2649717..2650610 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  WHO49_RS13930 yqeB 2650862..2651584 (+) 723 WP_010886572.1 hypothetical protein -
  WHO49_RS13935 nucA/comI 2651617..2652027 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  WHO49_RS13940 - 2652223..2652570 (+) 348 Protein_2699 sigma-70 family RNA polymerase sigma factor -
  WHO49_RS13945 spoIVCA 2652601..2654061 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  WHO49_RS13950 - 2654019..2654197 (-) 179 Protein_2701 hypothetical protein -
  WHO49_RS13955 arsC 2654552..2654971 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  WHO49_RS13960 acr3 2654983..2656023 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  WHO49_RS13965 yqcK 2656046..2656486 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  WHO49_RS13970 arsR 2656547..2656864 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  WHO49_RS13975 yqcI 2657236..2658000 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  WHO49_RS13980 rapE 2658443..2659570 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  WHO49_RS13985 phrE 2659560..2659694 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  WHO49_RS13990 - 2659804..2659962 (+) 159 WP_003245945.1 hypothetical protein -
  WHO49_RS13995 yqcG 2660332..2661927 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  WHO49_RS14000 yqcF 2661942..2662520 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  WHO49_RS14005 - 2662638..2662784 (+) 147 WP_009967791.1 hypothetical protein -
  WHO49_RS14010 - 2662781..2663143 (-) 363 WP_003229947.1 hypothetical protein -
  WHO49_RS14015 - 2663159..2663638 (-) 480 WP_004399085.1 hypothetical protein -
  WHO49_RS14020 cwlA 2663803..2664621 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  WHO49_RS14025 yqxH 2664666..2665088 (-) 423 WP_003246208.1 holin family protein -
  WHO49_RS14030 yqxG 2665133..2666026 (-) 894 WP_003246010.1 hypothetical protein -
  WHO49_RS14035 yqcE 2666114..2666278 (-) 165 WP_003229944.1 XkdX family protein -
  WHO49_RS14040 yqcD 2666275..2666610 (-) 336 WP_009967793.1 XkdW family protein -
  WHO49_RS14045 yqcC 2666620..2667720 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  WHO49_RS14050 - 2667723..2667995 (-) 273 WP_003229942.1 hypothetical protein -
  WHO49_RS14055 yqcA 2667992..2668570 (-) 579 WP_003229941.1 YmfQ family protein -
  WHO49_RS14060 yqbT 2668554..2669600 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  WHO49_RS14065 yqbS 2669593..2670018 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  WHO49_RS14070 yqbR 2670031..2670294 (-) 264 WP_003229938.1 DUF2577 family protein -
  WHO49_RS14075 yqbQ 2670291..2671271 (-) 981 WP_004398524.1 hypothetical protein -
  WHO49_RS14080 yqbP 2671284..2671943 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  WHO49_RS14085 yqbO 2671936..2676693 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  WHO49_RS14090 - 2676696..2676833 (-) 138 WP_003229934.1 hypothetical protein -
  WHO49_RS14095 - 2676875..2677324 (-) 450 WP_003229933.1 phage portal protein -
  WHO49_RS14100 txpA 2677470..2677649 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  WHO49_RS14105 bsrH 2678029..2678118 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  WHO49_RS14110 yqbM 2678372..2678815 (-) 444 WP_003229930.1 phage tail tube protein -
  WHO49_RS14115 yqbK 2678818..2680218 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  WHO49_RS14120 - 2680219..2680410 (-) 192 WP_010886574.1 hypothetical protein -
  WHO49_RS14125 yqbJ 2680407..2680844 (-) 438 WP_003229927.1 DUF6838 family protein -
  WHO49_RS14130 yqbI 2680857..2681360 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  WHO49_RS14135 yqbH 2681357..2681719 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  WHO49_RS14140 yqbG 2681716..2682111 (-) 396 WP_004398566.1 DUF3199 family protein -
  WHO49_RS14145 yqbF 2682115..2682426 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  WHO49_RS14150 yqbE 2682437..2683372 (-) 936 WP_003229922.1 phage major capsid protein -
  WHO49_RS14155 yqbD 2683391..2684359 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  WHO49_RS14160 - 2684392..2685045 (-) 654 WP_003229920.1 hypothetical protein -
  WHO49_RS14165 yqbB 2685086..2686003 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  WHO49_RS14170 yqbA 2686000..2687532 (-) 1533 WP_004398894.1 phage portal protein -
  WHO49_RS14175 yqaT 2687536..2688831 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  WHO49_RS14180 terS 2688824..2689543 (-) 720 WP_003229916.1 phage terminase small subunit -
  WHO49_RS14185 - 2689611..2690075 (-) 465 WP_004398685.1 hypothetical protein -
  WHO49_RS14190 yqaQ 2690219..2690674 (-) 456 WP_004398775.1 hypothetical protein -
  WHO49_RS14195 - 2690872..2691801 (+) 930 WP_003229913.1 hypothetical protein -
  WHO49_RS14200 yqaO 2691875..2692081 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  WHO49_RS14205 yqaN 2692163..2692591 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  WHO49_RS14210 - 2692687..2692836 (-) 150 WP_003229910.1 hypothetical protein -
  WHO49_RS14215 sknM 2692827..2693768 (-) 942 WP_075058863.1 ATP-binding protein -
  WHO49_RS14220 yqaL 2693650..2694327 (-) 678 WP_010886575.1 DnaD domain protein -
  WHO49_RS14225 yqaK 2694403..2695257 (-) 855 WP_003229907.1 recombinase RecT -
  WHO49_RS14230 yqaJ 2695260..2696219 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  WHO49_RS14235 - 2696325..2696519 (-) 195 WP_003229905.1 hypothetical protein -
  WHO49_RS14240 - 2696479..2696652 (-) 174 WP_119123069.1 hypothetical protein -
  WHO49_RS14245 sknH 2696649..2696906 (-) 258 WP_003245994.1 YqaH family protein -
  WHO49_RS14250 yqaG 2696903..2697472 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  WHO49_RS14255 - 2697546..2697686 (-) 141 WP_003229902.1 hypothetical protein -
  WHO49_RS14260 yqaF 2697716..2697946 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  WHO49_RS14265 sknR 2698123..2698473 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=950767 WHO49_RS13935 WP_009967785.1 2651617..2652027(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS499]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=950767 WHO49_RS13935 WP_009967785.1 2651617..2652027(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS499]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529