Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   WHL51_RS08495 Genome accession   NZ_CP148102
Coordinates   1647065..1647844 (+) Length   259 a.a.
NCBI ID   WP_003220850.1    Uniprot ID   G4NSM6
Organism   Bacillus spizizenii str. W23     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1621554..1662538 1647065..1647844 within 0


Gene organization within MGE regions


Location: 1621554..1662538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL51_RS08375 smc 1622255..1625815 (+) 3561 WP_003221570.1 chromosome segregation protein SMC -
  WHL51_RS08380 ftsY 1625835..1626824 (+) 990 WP_003221572.1 signal recognition particle-docking protein FtsY -
  WHL51_RS08385 - 1626959..1628058 (+) 1100 WP_230939496.1 IS3 family transposase -
  WHL51_RS08390 - 1628122..1628607 (-) 486 WP_003220807.1 Ig-like domain-containing protein -
  WHL51_RS08395 - 1628786..1629118 (+) 333 WP_003220809.1 putative DNA-binding protein -
  WHL51_RS08400 ffh 1629132..1630472 (+) 1341 WP_003220811.1 signal recognition particle protein -
  WHL51_RS08405 rpsP 1630578..1630850 (+) 273 WP_003220815.1 30S ribosomal protein S16 -
  WHL51_RS08410 - 1630850..1631095 (+) 246 WP_003220817.1 KH domain-containing protein -
  WHL51_RS08415 - 1631217..1631603 (+) 387 WP_003220819.1 YlqD family protein -
  WHL51_RS08420 rimM 1631608..1632132 (+) 525 WP_003220821.1 ribosome maturation factor RimM -
  WHL51_RS08425 trmD 1632129..1632860 (+) 732 WP_003220823.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  WHL51_RS08430 rplS 1633000..1633347 (+) 348 WP_003220825.1 50S ribosomal protein L19 -
  WHL51_RS08435 ylqF 1633492..1634340 (+) 849 WP_003220827.1 ribosome biogenesis GTPase YlqF -
  WHL51_RS08440 rnhB 1634411..1635178 (+) 768 WP_003220829.1 ribonuclease HII -
  WHL51_RS08445 - 1635207..1636937 (+) 1731 WP_003220832.1 hypothetical protein -
  WHL51_RS08450 - 1636934..1637215 (+) 282 WP_003220834.1 FlhB-like flagellar biosynthesis protein -
  WHL51_RS08455 sucC 1637389..1638546 (+) 1158 WP_003220835.1 ADP-forming succinate--CoA ligase subunit beta -
  WHL51_RS08460 sucD 1638575..1639477 (+) 903 WP_003220837.1 succinate--CoA ligase subunit alpha -
  WHL51_RS08465 dprA 1639538..1640431 (+) 894 WP_003220839.1 DNA-processing protein DprA Machinery gene
  WHL51_RS08470 topA 1640618..1642693 (+) 2076 WP_003220843.1 type I DNA topoisomerase -
  WHL51_RS08475 trmFO 1642769..1644076 (+) 1308 WP_003220844.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  WHL51_RS08480 xerC 1644144..1645058 (+) 915 WP_003220846.1 tyrosine recombinase XerC -
  WHL51_RS08485 clpQ 1645071..1645616 (+) 546 WP_003220848.1 ATP-dependent protease subunit ClpQ -
  WHL51_RS08490 hslU 1645633..1647025 (+) 1393 Protein_1628 HslU--HslV peptidase ATPase subunit -
  WHL51_RS08495 codY 1647065..1647844 (+) 780 WP_003220850.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  WHL51_RS08500 flgB 1648225..1648614 (+) 390 WP_003220852.1 flagellar basal body rod protein FlgB -
  WHL51_RS08505 flgC 1648614..1649066 (+) 453 WP_003220854.1 flagellar basal body rod protein FlgC -
  WHL51_RS08510 fliE 1649078..1649398 (+) 321 WP_003238544.1 flagellar hook-basal body complex protein FliE -
  WHL51_RS08515 fliF 1649444..1651054 (+) 1611 WP_079996358.1 flagellar basal-body MS-ring/collar protein FliF -
  WHL51_RS08520 fliG 1651067..1652083 (+) 1017 WP_003220860.1 flagellar motor switch protein FliG -
  WHL51_RS08525 fliH 1652076..1652828 (+) 753 WP_003220862.1 flagellar assembly protein FliH -
  WHL51_RS08530 fliI 1652825..1654141 (+) 1317 WP_003220864.1 flagellar protein export ATPase FliI -
  WHL51_RS08535 fliJ 1654144..1654587 (+) 444 WP_003220866.1 flagellar export protein FliJ -
  WHL51_RS08540 - 1654599..1655213 (+) 615 WP_003220869.1 MotE family protein -
  WHL51_RS08545 - 1655225..1656688 (+) 1464 WP_003220871.1 flagellar hook-length control protein FliK -
  WHL51_RS08550 flgD 1656685..1657107 (+) 423 WP_003220873.1 flagellar hook assembly protein FlgD -
  WHL51_RS08555 flgG 1657129..1657923 (+) 795 WP_003220874.1 flagellar basal body rod protein FlgG -
  WHL51_RS08560 swrD 1657963..1658178 (+) 216 WP_003220876.1 swarming motility protein SwrD -
  WHL51_RS08565 fliL 1658175..1658600 (+) 426 WP_003220878.1 flagellar basal body-associated protein FliL -
  WHL51_RS08570 fliM 1658634..1659632 (+) 999 WP_003220879.1 flagellar motor switch protein FliM -
  WHL51_RS08575 fliY 1659622..1660761 (+) 1140 WP_003220881.1 flagellar motor switch phosphatase FliY -
  WHL51_RS08580 cheY 1660787..1661149 (+) 363 WP_003220882.1 chemotaxis protein CheY -
  WHL51_RS08585 fliZ 1661164..1661823 (+) 660 WP_003220884.1 flagella biosynthesis regulatory protein FliZ -
  WHL51_RS08590 fliP 1661816..1662481 (+) 666 WP_003220886.1 flagellar type III secretion system pore protein FliP -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 29013.22 Da        Isoelectric Point: 4.6514

>NTDB_id=950425 WHL51_RS08495 WP_003220850.1 1647065..1647844(+) (codY) [Bacillus spizizenii str. W23]
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLF
NVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNNKFLIELENLKSH

Nucleotide


Download         Length: 780 bp        

>NTDB_id=950425 WHL51_RS08495 WP_003220850.1 1647065..1647844(+) (codY) [Bacillus spizizenii str. W23]
ATGGCTTTATTACAAAAAACACGAATTATTAACTCCATGCTGCAAGCTGCGGCAGGGAAACCGGTAAACTTCAAGGAAAT
GGCGGAGACGCTGCGGGATGTAATTGATTCCAATATTTTCGTTGTAAGCCGCAGAGGCAAACTCCTTGGATATTCTATTA
ACCAGCAAATTGAAAATGATCGTATGAAAAAAATGCTTGAGGATCGTCAATTCCCTGAAGAATATACGAAAAATCTATTT
AACGTCCCTGAAACATCTTCTAACTTGGACATTAATAGTGAATATACTGCTTTTCCTGTTGAGAACAGAGACTTGTTTCA
AGCTGGTTTAACAACAATTGTACCGATCATCGGAGGCGGAGAAAGATTAGGAACACTCATTCTTTCACGTTTACAGGATC
AATTTAATGACGATGACTTAATTCTCGCTGAATACGGCGCTACAGTTGTCGGTATGGAGATCCTGAGAGAAAAAGCAGAA
GAAATCGAAGAGGAAGCAAGAAGCAAAGCTGTCGTTCAAATGGCTATCAGTTCTCTTTCTTACAGTGAGCTTGAAGCAAT
TGAGCACATTTTTGAAGAGCTTGACGGAAACGAAGGTCTTCTCGTTGCAAGTAAAATCGCTGACCGCGTCGGGATTACCC
GTTCTGTTATTGTGAATGCACTCAGAAAGCTGGAAAGCGCGGGTGTTATCGAGTCAAGATCATTAGGAATGAAAGGTACT
TATATCAAAGTCCTAAACAATAAATTCCTAATCGAATTAGAAAATCTAAAATCTCATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NSM6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

100

100

1

  codY Lactococcus lactis subsp. lactis strain DGCC12653

47.451

98.456

0.467