Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WFE12_RS17230 Genome accession   NZ_CP147877
Coordinates   3257264..3257431 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252264..3262431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WFE12_RS17200 mrpE 3252659..3253135 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WFE12_RS17205 mrpF 3253135..3253419 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WFE12_RS17210 mnhG 3253403..3253777 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WFE12_RS17215 yuxO 3253816..3254196 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WFE12_RS17220 comA 3254215..3254859 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WFE12_RS17225 comP 3254940..3257249 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  WFE12_RS17230 comX 3257264..3257431 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WFE12_RS17235 comQ 3257419..3258318 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WFE12_RS17240 degQ 3258503..3258643 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WFE12_RS17245 - 3258865..3258990 (+) 126 WP_003228793.1 hypothetical protein -
  WFE12_RS17250 - 3259104..3259472 (+) 369 WP_003243784.1 hypothetical protein -
  WFE12_RS17255 pdeH 3259448..3260677 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WFE12_RS17260 pncB 3260814..3262286 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=949169 WFE12_RS17230 WP_003242801.1 3257264..3257431(-) (comX) [Bacillus subtilis subsp. subtilis str. 168]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=949169 WFE12_RS17230 WP_003242801.1 3257264..3257431(-) (comX) [Bacillus subtilis subsp. subtilis str. 168]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1