Detailed information    

insolico Bioinformatically predicted

Overview


Name   comFC   Type   Machinery gene
Locus tag   V7S31_RS18140 Genome accession   NZ_CP147655
Coordinates   3683512..3684201 (-) Length   229 a.a.
NCBI ID   WP_198161198.1    Uniprot ID   -
Organism   Bacillus velezensis strain M1     
Function   ssDNA transport into the cell (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3618867..3702707 3683512..3684201 within 0


Gene organization within MGE regions


Location: 3618867..3702707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S31_RS17830 - 3619146..3620558 (-) 1413 WP_007407424.1 NlpC/P60 family protein -
  V7S31_RS17835 - 3620955..3622409 (-) 1455 WP_108725287.1 tetratricopeptide repeat protein -
  V7S31_RS17840 - 3622525..3623586 (-) 1062 WP_007614006.1 HAMP domain-containing sensor histidine kinase -
  V7S31_RS17845 - 3623583..3624260 (-) 678 WP_012118540.1 response regulator transcription factor -
  V7S31_RS17850 - 3624456..3626225 (-) 1770 WP_174737094.1 ABC transporter ATP-binding protein -
  V7S31_RS17855 hisIE 3626437..3627057 (-) 621 WP_007407429.1 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE -
  V7S31_RS17860 hisF 3627054..3627812 (-) 759 WP_014418971.1 imidazole glycerol phosphate synthase subunit HisF -
  V7S31_RS17865 hisA 3627809..3628546 (-) 738 WP_007407431.1 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
  V7S31_RS17870 hisH 3628543..3629181 (-) 639 WP_007407432.1 imidazole glycerol phosphate synthase subunit HisH -
  V7S31_RS17875 hisB 3629182..3629766 (-) 585 WP_020956403.1 imidazoleglycerol-phosphate dehydratase HisB -
  V7S31_RS17880 hisD 3629732..3631045 (-) 1314 WP_338816552.1 histidinol dehydrogenase -
  V7S31_RS17885 hisG 3631042..3631683 (-) 642 WP_012118547.1 ATP phosphoribosyltransferase -
  V7S31_RS17890 - 3631676..3632848 (-) 1173 WP_338816554.1 ATP phosphoribosyltransferase regulatory subunit -
  V7S31_RS17895 - 3633090..3633815 (+) 726 WP_338816555.1 C39 family peptidase -
  V7S31_RS17900 - 3633832..3634350 (-) 519 WP_338816556.1 acyltransferase -
  V7S31_RS17905 ppaX 3634354..3635004 (-) 651 WP_007407439.1 pyrophosphatase PpaX -
  V7S31_RS17910 lgt 3635030..3635845 (-) 816 WP_007407440.1 prolipoprotein diacylglyceryl transferase -
  V7S31_RS17915 hprK 3635860..3636792 (-) 933 WP_013353746.1 HPr(Ser) kinase/phosphatase -
  V7S31_RS17920 nagA 3636962..3638152 (+) 1191 WP_007407441.1 N-acetylglucosamine-6-phosphate deacetylase -
  V7S31_RS17925 nagB 3638149..3638874 (+) 726 WP_039063705.1 glucosamine-6-phosphate deaminase -
  V7S31_RS17930 - 3638888..3639619 (+) 732 WP_039063706.1 GntR family transcriptional regulator -
  V7S31_RS17935 - 3639764..3640339 (-) 576 WP_015418312.1 TetR/AcrR family transcriptional regulator -
  V7S31_RS17940 - 3640507..3644376 (-) 3870 WP_039063707.1 metallophosphoesterase -
  V7S31_RS17945 - 3644470..3644829 (-) 360 WP_007407446.1 phage holin family protein -
  V7S31_RS17950 - 3644830..3645024 (-) 195 WP_007407447.1 PspC domain-containing protein -
  V7S31_RS17955 - 3645029..3646126 (-) 1098 WP_007407448.1 DUF4097 domain-containing protein -
  V7S31_RS17960 - 3646151..3646477 (-) 327 WP_003151444.1 hypothetical protein -
  V7S31_RS17965 - 3646675..3646935 (+) 261 WP_039063708.1 hypothetical protein -
  V7S31_RS17970 uvrA 3646961..3649834 (-) 2874 WP_020954334.1 excinuclease ABC subunit UvrA -
  V7S31_RS17975 uvrB 3649842..3651827 (-) 1986 WP_003151439.1 excinuclease ABC subunit UvrB -
  V7S31_RS17980 - 3652003..3652239 (-) 237 WP_003151438.1 CsbA family protein -
  V7S31_RS17985 - 3652541..3655042 (+) 2502 WP_007407453.1 PEP/pyruvate-binding domain-containing protein -
  V7S31_RS17990 - 3655114..3655737 (+) 624 WP_015240677.1 TetR/AcrR family transcriptional regulator -
  V7S31_RS17995 - 3655710..3657047 (+) 1338 WP_007407455.1 MFS transporter -
  V7S31_RS18000 - 3657645..3658456 (+) 812 Protein_3481 IS3 family transposase -
  V7S31_RS18005 - 3658593..3659176 (-) 584 Protein_3482 transposase -
  V7S31_RS18010 - 3659333..3660106 (-) 774 WP_052248602.1 thioesterase domain-containing protein -
  V7S31_RS18015 - 3660157..3661227 (-) 1071 WP_039063709.1 DUF3810 domain-containing protein -
  V7S31_RS18020 - 3661506..3662696 (-) 1191 WP_039063710.1 S1C family serine protease -
  V7S31_RS18025 swrA 3662771..3663124 (-) 354 WP_014305920.1 swarming motility protein SwrAA -
  V7S31_RS18030 - 3663497..3664897 (-) 1401 WP_039063711.1 S41 family peptidase -
  V7S31_RS18035 - 3665065..3666471 (+) 1407 WP_039063713.1 right-handed parallel beta-helix repeat-containing protein -
  V7S31_RS18040 ftsX 3666518..3667408 (-) 891 WP_039063751.1 permease-like cell division protein FtsX -
  V7S31_RS18045 ftsE 3667401..3668087 (-) 687 WP_007407465.1 cell division ATP-binding protein FtsE -
  V7S31_RS18050 cccB 3668306..3668647 (-) 342 WP_039063714.1 cytochrome c551 -
  V7S31_RS18055 - 3668683..3669531 (-) 849 WP_039063715.1 YitT family protein -
  V7S31_RS18065 secA 3670877..3673402 (-) 2526 WP_007407469.1 preprotein translocase subunit SecA -
  V7S31_RS18070 raiA 3673569..3674135 (-) 567 WP_003151413.1 ribosome-associated translation inhibitor RaiA -
  V7S31_RS18075 - 3674330..3674707 (-) 378 WP_003151412.1 hypothetical protein -
  V7S31_RS18080 fliT 3674717..3675061 (-) 345 WP_007407472.1 flagella biosynthesis regulatory protein FliT -
  V7S31_RS18085 fliS 3675061..3675462 (-) 402 WP_003151407.1 flagellar export chaperone FliS -
  V7S31_RS18090 - 3675482..3677002 (-) 1521 WP_039063716.1 flagellar hook-associated protein 2 -
  V7S31_RS18095 - 3677253..3678239 (-) 987 WP_007407474.1 flagellin -
  V7S31_RS18100 csrA 3678384..3678608 (-) 225 WP_003151402.1 carbon storage regulator CsrA -
  V7S31_RS18105 fliW 3678602..3679033 (-) 432 WP_007407475.1 flagellar assembly protein FliW -
  V7S31_RS18110 - 3679063..3679632 (-) 570 WP_007407476.1 DUF6470 family protein -
  V7S31_RS18115 flgL 3679724..3680641 (-) 918 WP_003151396.1 flagellar hook-associated protein FlgL -
  V7S31_RS18120 flgK 3680653..3682170 (-) 1518 WP_039063717.1 flagellar hook-associated protein FlgK -
  V7S31_RS18125 - 3682186..3682668 (-) 483 WP_003151394.1 flagellar protein FlgN -
  V7S31_RS18130 flgM 3682683..3682949 (-) 267 WP_003151393.1 flagellar biosynthesis anti-sigma factor FlgM -
  V7S31_RS18135 - 3683019..3683438 (-) 420 WP_025285352.1 TIGR03826 family flagellar region protein -
  V7S31_RS18140 comFC 3683512..3684201 (-) 690 WP_198161198.1 phosphoribosyltransferase family protein Machinery gene
  V7S31_RS18145 - 3684207..3684491 (-) 285 WP_007407481.1 competence protein ComFB -
  V7S31_RS18150 comFA 3684549..3685934 (-) 1386 WP_039063725.1 DEAD/DEAH box helicase Machinery gene
  V7S31_RS18155 - 3686042..3686890 (-) 849 WP_007407483.1 DegV family protein -
  V7S31_RS18160 degU 3686988..3687677 (-) 690 WP_003219701.1 two-component system response regulator DegU Regulator
  V7S31_RS18165 degS 3687754..3688917 (-) 1164 WP_007407484.1 two-component sensor histidine kinase DegS Regulator
  V7S31_RS18170 - 3689140..3689787 (+) 648 WP_007407485.1 YigZ family protein -
  V7S31_RS18175 - 3689792..3691012 (+) 1221 WP_007407486.1 LCP family protein -
  V7S31_RS18180 - 3691111..3692187 (-) 1077 WP_003151382.1 MraY family glycosyltransferase -
  V7S31_RS18185 - 3692320..3693516 (-) 1197 WP_338816560.1 glycosyltransferase -
  V7S31_RS18190 - 3693536..3694294 (-) 759 WP_003151380.1 glycosyltransferase family 2 protein -
  V7S31_RS18195 - 3694318..3694998 (-) 681 WP_007407488.1 TuaF -
  V7S31_RS18200 - 3694995..3696482 (-) 1488 WP_032869544.1 O-antigen ligase family protein -
  V7S31_RS18205 - 3696549..3697889 (-) 1341 WP_032867088.1 UDP-glucose/GDP-mannose dehydrogenase family protein -
  V7S31_RS18210 - 3697894..3699090 (-) 1197 WP_338816561.1 glycosyltransferase family 4 protein -
  V7S31_RS18215 - 3699087..3700535 (-) 1449 WP_039063730.1 MOP flippase family protein -
  V7S31_RS18220 - 3700572..3701231 (-) 660 WP_003151373.1 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase -

Sequence


Protein


Download         Length: 229 a.a.        Molecular weight: 25215.80 Da        Isoelectric Point: 8.0779

>NTDB_id=947893 V7S31_RS18140 WP_198161198.1 3683512..3684201(-) (comFC) [Bacillus velezensis strain M1]
MNCLLCDSPISSSLTWRSLFSLAPEQEVCSICSSQFEKIEGPVCSICGRPQESNEKCADCAARESKTEKRFLLRQNRSVY
LYNDAMKDSLARFKFRGDAKIIQAFERDFAAGFKAAYPSNTHTLIPIPLSGERLAERGFNQSELLASLLGMPVISPLIRL
NNEKQSKKSKTDRLSAEKKFSAAENSAEGMNVILIDDIYTTGATLHQAAEVLLTAGKASSVSSFTLIRS

Nucleotide


Download         Length: 690 bp        

>NTDB_id=947893 V7S31_RS18140 WP_198161198.1 3683512..3684201(-) (comFC) [Bacillus velezensis strain M1]
CTGAATTGTTTATTGTGTGACTCACCAATTTCAAGTTCATTGACTTGGAGATCTCTATTTTCTCTGGCGCCCGAGCAAGA
GGTATGCAGCATATGCAGCAGCCAATTCGAAAAAATTGAAGGCCCCGTATGCAGTATATGCGGGAGGCCTCAGGAGTCAA
ATGAAAAATGCGCTGATTGTGCGGCCCGGGAATCAAAAACGGAAAAGCGCTTTTTGCTGCGGCAAAACCGTTCGGTATAT
TTATATAATGATGCGATGAAGGACTCATTGGCCCGTTTTAAATTCAGGGGTGATGCGAAAATCATTCAAGCATTTGAACG
TGACTTTGCTGCCGGCTTTAAAGCGGCATATCCATCAAATACACATACTCTCATCCCTATTCCGCTGAGCGGCGAACGGC
TGGCGGAACGCGGATTCAATCAATCCGAGCTGCTGGCCTCTCTGCTCGGAATGCCTGTCATTTCCCCCCTCATCCGACTG
AACAACGAAAAACAATCCAAAAAGAGCAAAACAGATAGGCTGTCTGCAGAAAAAAAGTTTTCAGCAGCCGAAAACTCCGC
CGAAGGTATGAACGTCATTTTAATAGATGATATTTATACGACGGGCGCCACACTTCACCAAGCCGCCGAAGTCCTGCTGA
CAGCGGGCAAAGCGTCATCGGTCTCCTCTTTTACTTTAATCAGGAGCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comFC Bacillus subtilis subsp. subtilis str. 168

60.352

99.127

0.598