Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V7S31_RS16075 Genome accession   NZ_CP147655
Coordinates   3286053..3286193 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain M1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3281053..3291193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S31_RS16050 - 3281349..3281732 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  V7S31_RS16055 comA 3281754..3282398 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V7S31_RS16060 comP 3282479..3284788 (-) 2310 WP_033574914.1 histidine kinase Regulator
  V7S31_RS16065 comX 3284808..3284984 (-) 177 WP_007408675.1 competence pheromone ComX -
  V7S31_RS16070 comQ 3284984..3285922 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  V7S31_RS16075 degQ 3286053..3286193 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V7S31_RS16080 - 3286659..3287000 (+) 342 WP_015418107.1 hypothetical protein -
  V7S31_RS16085 - 3287007..3288230 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  V7S31_RS16090 - 3288360..3289826 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  V7S31_RS16095 - 3289844..3290395 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  V7S31_RS16100 - 3290492..3290890 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=947890 V7S31_RS16075 WP_003152043.1 3286053..3286193(-) (degQ) [Bacillus velezensis strain M1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=947890 V7S31_RS16075 WP_003152043.1 3286053..3286193(-) (degQ) [Bacillus velezensis strain M1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891