Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   V7S31_RS13115 Genome accession   NZ_CP147655
Coordinates   2715241..2715507 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain M1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2710241..2720507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S31_RS13065 sinR 2710405..2710740 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V7S31_RS13070 - 2710788..2711573 (-) 786 WP_007408329.1 TasA family protein -
  V7S31_RS13075 - 2711638..2712222 (-) 585 WP_007408328.1 signal peptidase I -
  V7S31_RS13080 tapA 2712194..2712865 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  V7S31_RS13085 - 2713124..2713453 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  V7S31_RS13090 - 2713493..2713672 (-) 180 WP_003153093.1 YqzE family protein -
  V7S31_RS13095 comGG 2713729..2714106 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  V7S31_RS13100 comGF 2714107..2714607 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  V7S31_RS13105 comGE 2714516..2714830 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  V7S31_RS13110 comGD 2714814..2715251 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  V7S31_RS13115 comGC 2715241..2715507 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  V7S31_RS13120 comGB 2715554..2716591 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  V7S31_RS13125 comGA 2716578..2717648 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  V7S31_RS13130 - 2717840..2718790 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -
  V7S31_RS13135 - 2718936..2720237 (+) 1302 WP_338816384.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=947872 V7S31_RS13115 WP_042635730.1 2715241..2715507(-) (comGC) [Bacillus velezensis strain M1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=947872 V7S31_RS13115 WP_042635730.1 2715241..2715507(-) (comGC) [Bacillus velezensis strain M1]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602