Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   V7S31_RS03340 Genome accession   NZ_CP147655
Coordinates   671754..671873 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain M1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 666754..676873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S31_RS03325 - 668366..669049 (+) 684 WP_007410267.1 response regulator transcription factor -
  V7S31_RS03330 - 669036..670469 (+) 1434 WP_020953885.1 ATP-binding protein -
  V7S31_RS03335 rapC 670622..671770 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  V7S31_RS03340 phrC 671754..671873 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  V7S31_RS03345 - 672021..672116 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  V7S31_RS03350 - 672211..673575 (-) 1365 WP_020955323.1 aspartate kinase -
  V7S31_RS03355 ceuB 673989..674942 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  V7S31_RS03360 - 674932..675879 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  V7S31_RS03365 - 675873..676631 (+) 759 WP_039062614.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=947839 V7S31_RS03340 WP_003156334.1 671754..671873(+) (phrC) [Bacillus velezensis strain M1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=947839 V7S31_RS03340 WP_003156334.1 671754..671873(+) (phrC) [Bacillus velezensis strain M1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718