Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WBM82_RS13170 Genome accession   NZ_CP147494
Coordinates   2491158..2491331 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain YT1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2486158..2496331
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBM82_RS13155 (WBM82_13200) gcvT 2486957..2488045 (-) 1089 WP_217024280.1 glycine cleavage system aminomethyltransferase GcvT -
  WBM82_RS13160 (WBM82_13205) yqhH 2488487..2490160 (+) 1674 WP_085186487.1 SNF2-related protein -
  WBM82_RS13165 (WBM82_13210) yqhG 2490181..2490975 (+) 795 WP_003230200.1 YqhG family protein -
  WBM82_RS13170 (WBM82_13215) sinI 2491158..2491331 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WBM82_RS13175 (WBM82_13220) sinR 2491365..2491700 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WBM82_RS13180 (WBM82_13225) tasA 2491793..2492578 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  WBM82_RS13185 (WBM82_13230) sipW 2492642..2493214 (-) 573 WP_072692741.1 signal peptidase I -
  WBM82_RS13190 (WBM82_13235) tapA 2493198..2493959 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WBM82_RS13195 (WBM82_13240) yqzG 2494231..2494557 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WBM82_RS13200 (WBM82_13245) spoIIT 2494599..2494778 (-) 180 WP_029726723.1 YqzE family protein -
  WBM82_RS13205 (WBM82_13250) comGG 2494850..2495224 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  WBM82_RS13210 (WBM82_13255) comGF 2495225..2495608 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  WBM82_RS13215 (WBM82_13260) comGE 2495634..2495981 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=946423 WBM82_RS13170 WP_003230187.1 2491158..2491331(+) (sinI) [Bacillus subtilis strain YT1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=946423 WBM82_RS13170 WP_003230187.1 2491158..2491331(+) (sinI) [Bacillus subtilis strain YT1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1