Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ACFIGL_RS17220 Genome accession   NZ_CP170734
Coordinates   3255549..3255716 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain M51     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250549..3260716
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFIGL_RS17190 (ACFIGL_17200) mrpE 3250945..3251421 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  ACFIGL_RS17195 (ACFIGL_17205) mrpF 3251421..3251705 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ACFIGL_RS17200 (ACFIGL_17210) mnhG 3251689..3252063 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  ACFIGL_RS17205 (ACFIGL_17215) yuxO 3252102..3252482 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACFIGL_RS17210 (ACFIGL_17220) comA 3252501..3253145 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACFIGL_RS17215 (ACFIGL_17225) comP 3253226..3255534 (-) 2309 Protein_3327 two-component system sensor histidine kinase ComP -
  ACFIGL_RS17220 (ACFIGL_17230) comX 3255549..3255716 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACFIGL_RS17225 (ACFIGL_17235) comQ 3255704..3256603 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACFIGL_RS17230 (ACFIGL_17240) degQ 3256788..3256928 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACFIGL_RS17235 (ACFIGL_17245) - 3257150..3257275 (+) 126 WP_003228793.1 hypothetical protein -
  ACFIGL_RS17240 (ACFIGL_17250) - 3257389..3257757 (+) 369 WP_003243784.1 hypothetical protein -
  ACFIGL_RS17245 (ACFIGL_17255) pdeH 3257733..3258962 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACFIGL_RS17250 (ACFIGL_17260) pncB 3259099..3260571 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=945546 ACFIGL_RS17220 WP_003242801.1 3255549..3255716(-) (comX) [Bacillus subtilis strain M51]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=945546 ACFIGL_RS17220 WP_003242801.1 3255549..3255716(-) (comX) [Bacillus subtilis strain M51]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1