Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   WAA17_RS12615 Genome accession   NZ_CP147000
Coordinates   2592533..2592847 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis isolate K8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2587533..2597847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WAA17_RS12570 (WAA17_12570) sinI 2588215..2588388 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  WAA17_RS12575 (WAA17_12575) sinR 2588422..2588757 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WAA17_RS12580 (WAA17_12580) - 2588805..2589590 (-) 786 WP_015388008.1 TasA family protein -
  WAA17_RS12585 (WAA17_12585) - 2589654..2590238 (-) 585 WP_003153100.1 signal peptidase I -
  WAA17_RS12590 (WAA17_12590) tapA 2590210..2590881 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  WAA17_RS12595 (WAA17_12595) - 2591141..2591470 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  WAA17_RS12600 (WAA17_12600) - 2591510..2591689 (-) 180 WP_003153093.1 YqzE family protein -
  WAA17_RS12605 (WAA17_12605) comGG 2591746..2592123 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  WAA17_RS12610 (WAA17_12610) comGF 2592124..2592624 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  WAA17_RS12615 (WAA17_12615) comGE 2592533..2592847 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  WAA17_RS12620 (WAA17_12620) comGD 2592831..2593268 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  WAA17_RS12625 (WAA17_12625) comGC 2593258..2593566 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  WAA17_RS12630 (WAA17_12630) comGB 2593571..2594608 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  WAA17_RS12635 (WAA17_12635) comGA 2594595..2595665 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  WAA17_RS12640 (WAA17_12640) - 2595857..2596807 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=945529 WAA17_RS12615 WP_015388003.1 2592533..2592847(-) (comGE) [Bacillus velezensis isolate K8]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=945529 WAA17_RS12615 WP_015388003.1 2592533..2592847(-) (comGE) [Bacillus velezensis isolate K8]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481