Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFIGL_RS13345 Genome accession   NZ_CP170734
Coordinates   2552140..2552313 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain M51     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547140..2557313
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFIGL_RS13330 (ACFIGL_13340) gcvT 2547939..2549027 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFIGL_RS13335 (ACFIGL_13345) hepAA 2549469..2551142 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ACFIGL_RS13340 (ACFIGL_13350) yqhG 2551163..2551957 (+) 795 WP_003230200.1 YqhG family protein -
  ACFIGL_RS13345 (ACFIGL_13355) sinI 2552140..2552313 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACFIGL_RS13350 (ACFIGL_13360) sinR 2552347..2552682 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACFIGL_RS13355 (ACFIGL_13365) tasA 2552775..2553560 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACFIGL_RS13360 (ACFIGL_13370) sipW 2553624..2554196 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACFIGL_RS13365 (ACFIGL_13375) tapA 2554180..2554941 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACFIGL_RS13370 (ACFIGL_13380) yqzG 2555213..2555539 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACFIGL_RS13375 (ACFIGL_13385) spoIITA 2555581..2555760 (-) 180 WP_003230176.1 YqzE family protein -
  ACFIGL_RS13380 (ACFIGL_13390) comGG 2555831..2556205 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACFIGL_RS13385 (ACFIGL_13395) comGF 2556206..2556589 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACFIGL_RS13390 (ACFIGL_13400) comGE 2556615..2556962 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=945512 ACFIGL_RS13345 WP_003230187.1 2552140..2552313(+) (sinI) [Bacillus subtilis strain M51]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=945512 ACFIGL_RS13345 WP_003230187.1 2552140..2552313(+) (sinI) [Bacillus subtilis strain M51]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1