Detailed information    

insolico Bioinformatically predicted

Overview


Name   comEC   Type   Machinery gene
Locus tag   V4Q90_RS11910 Genome accession   NZ_CP146990
Coordinates   2677849..2678658 (+) Length   269 a.a.
NCBI ID   WP_011212818.1    Uniprot ID   A0AAN5PKE2
Organism   Legionella pneumophila strain LEG1116     
Function   ssDNA transport through the inner membrane (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2614031..2684483 2677849..2678658 within 0


Gene organization within MGE regions


Location: 2614031..2684483
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V4Q90_RS11660 (V4Q90_11625) - 2614969..2616267 (+) 1299 WP_010945883.1 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein -
  V4Q90_RS11665 (V4Q90_11630) - 2616428..2617042 (-) 615 WP_011212772.1 thiol:disulfide interchange protein DsbA/DsbL -
  V4Q90_RS11670 (V4Q90_11635) - 2617053..2617655 (-) 603 WP_011212773.1 c-type cytochrome -
  V4Q90_RS11675 (V4Q90_11640) yihA 2617730..2618332 (+) 603 WP_011212774.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  V4Q90_RS11680 (V4Q90_11645) cegC2 2618446..2621757 (+) 3312 WP_011212775.1 Dot/Icm T4SS effector CegC2 -
  V4Q90_RS11685 (V4Q90_11650) acs 2621854..2623737 (-) 1884 WP_025519195.1 acetate--CoA ligase -
  V4Q90_RS11690 (V4Q90_11655) mmsB 2623739..2624635 (-) 897 WP_011212777.1 3-hydroxyisobutyrate dehydrogenase -
  V4Q90_RS11695 (V4Q90_11660) - 2624659..2626158 (-) 1500 WP_011212778.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -
  V4Q90_RS11700 (V4Q90_11665) - 2626269..2626445 (-) 177 WP_011212779.1 dodecin domain-containing protein -
  V4Q90_RS11705 (V4Q90_11670) - 2626623..2629091 (+) 2469 WP_011212780.1 hypothetical protein -
  V4Q90_RS11710 (V4Q90_11675) dapB 2629195..2629926 (-) 732 WP_011212781.1 4-hydroxy-tetrahydrodipicolinate reductase -
  V4Q90_RS11715 (V4Q90_11680) - 2630106..2630291 (-) 186 WP_011212782.1 hypothetical protein -
  V4Q90_RS11720 (V4Q90_11685) rocC 2630648..2631340 (+) 693 WP_011212783.1 ProQ/FinO family protein Regulator
  V4Q90_RS11725 (V4Q90_11690) - 2631341..2632411 (+) 1071 WP_011212784.1 hypothetical protein -
  V4Q90_RS11730 (V4Q90_11695) - 2632511..2638138 (-) 5628 WP_350534576.1 SdhB -
  V4Q90_RS11735 (V4Q90_11700) pyk 2638230..2639654 (-) 1425 WP_011212786.1 pyruvate kinase -
  V4Q90_RS11740 (V4Q90_11705) - 2639638..2640828 (-) 1191 WP_011212787.1 phosphoglycerate kinase -
  V4Q90_RS11745 (V4Q90_11710) gap 2640839..2641831 (-) 993 WP_011212788.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  V4Q90_RS11750 (V4Q90_11715) tkt 2641912..2643990 (-) 2079 WP_080019868.1 transketolase -
  V4Q90_RS11755 (V4Q90_11720) - 2644176..2645510 (+) 1335 WP_011212790.1 hypothetical protein -
  V4Q90_RS11760 (V4Q90_11725) - 2645610..2647625 (+) 2016 WP_025519199.1 M3 family metallopeptidase -
  V4Q90_RS11770 (V4Q90_11735) - 2648432..2648752 (+) 321 WP_126297580.1 hypothetical protein -
  V4Q90_RS11775 (V4Q90_11740) cas9 2649228..2653346 (+) 4119 WP_011212792.1 type II-B CRISPR-associated RNA-guided endonuclease Cas9/Csx12 -
  V4Q90_RS11780 (V4Q90_11745) cas1 2653343..2654335 (+) 993 WP_011212793.1 CRISPR-associated endonuclease Cas1 -
  V4Q90_RS11785 (V4Q90_11750) cas2 2654342..2654641 (+) 300 WP_011212794.1 CRISPR-associated endonuclease Cas2 -
  V4Q90_RS11790 (V4Q90_11755) cas4 2654622..2655215 (+) 594 WP_011212795.1 CRISPR-associated protein Cas4 -
  V4Q90_RS11795 (V4Q90_11760) - 2658253..2658690 (+) 438 WP_021437110.1 YgjP-like metallopeptidase domain-containing protein -
  V4Q90_RS11800 (V4Q90_11765) - 2658680..2659354 (-) 675 WP_025519205.1 S24 family peptidase -
  V4Q90_RS11805 (V4Q90_11770) - 2659516..2660385 (+) 870 WP_011212797.1 hypothetical protein -
  V4Q90_RS11810 (V4Q90_11775) - 2660351..2660713 (+) 363 WP_021437111.1 hypothetical protein -
  V4Q90_RS11815 (V4Q90_11780) - 2660726..2660929 (+) 204 WP_011212799.1 carbon storage regulator -
  V4Q90_RS11820 (V4Q90_11785) - 2660926..2661228 (+) 303 WP_011212800.1 TrbC/VirB2 family protein -
  V4Q90_RS11825 (V4Q90_11790) - 2661238..2661519 (+) 282 WP_011212801.1 VirB3 family type IV secretion system protein -
  V4Q90_RS11830 (V4Q90_11795) - 2661506..2663986 (+) 2481 WP_011212802.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  V4Q90_RS11835 (V4Q90_11800) - 2663983..2664693 (+) 711 WP_011212803.1 type IV secretion system protein -
  V4Q90_RS11840 (V4Q90_11805) lvhB7 2664708..2664854 (+) 147 WP_011212804.1 T4SS-associated protein LvhB7 -
  V4Q90_RS11845 (V4Q90_11810) lvrD 2664851..2665246 (+) 396 WP_011212805.1 T4SS-associated protein LvrD -
  V4Q90_RS11850 (V4Q90_11815) - 2665250..2666290 (+) 1041 WP_011212806.1 type IV secretion system protein -
  V4Q90_RS11855 (V4Q90_11820) - 2666287..2667003 (+) 717 WP_011212807.1 type IV secretion system protein -
  V4Q90_RS11860 (V4Q90_11825) virB9 2667000..2667752 (+) 753 WP_011212808.1 P-type conjugative transfer protein VirB9 -
  V4Q90_RS11865 (V4Q90_11830) - 2667749..2668840 (+) 1092 WP_011212809.1 TrbI/VirB10 family protein -
  V4Q90_RS11870 (V4Q90_11835) virB11 2668842..2669846 (+) 1005 WP_011212810.1 P-type DNA transfer ATPase VirB11 -
  V4Q90_RS11875 (V4Q90_11840) - 2669839..2671740 (+) 1902 WP_011212811.1 type IV secretory system conjugative DNA transfer family protein -
  V4Q90_RS11880 (V4Q90_11845) - 2671838..2672635 (+) 798 WP_011212812.1 DUF1566 domain-containing protein -
  V4Q90_RS11885 (V4Q90_11850) - 2672869..2673630 (+) 762 WP_126297581.1 hypothetical protein -
  V4Q90_RS11890 (V4Q90_11855) traA 2673754..2676393 (-) 2640 WP_011212814.1 Ti-type conjugative transfer relaxase TraA -
  V4Q90_RS11895 (V4Q90_11860) - 2676642..2676848 (+) 207 WP_011212815.1 hypothetical protein -
  V4Q90_RS11900 (V4Q90_11865) - 2676835..2677104 (+) 270 WP_011212816.1 conjugal transfer protein TraD -
  V4Q90_RS11905 (V4Q90_11870) - 2677198..2677845 (+) 648 WP_011212817.1 hypothetical protein -
  V4Q90_RS11910 (V4Q90_11875) comEC 2677849..2678658 (+) 810 WP_011212818.1 hypothetical protein Machinery gene
  V4Q90_RS11915 (V4Q90_11880) - 2678685..2679146 (-) 462 WP_011212819.1 nucleoside deaminase -
  V4Q90_RS11920 (V4Q90_11885) - 2679139..2680566 (-) 1428 WP_011212820.1 VUT family protein -
  V4Q90_RS11925 (V4Q90_11890) - 2680559..2680918 (-) 360 WP_011212821.1 hypothetical protein -
  V4Q90_RS11930 (V4Q90_11895) - 2680935..2681582 (-) 648 WP_011212822.1 LexA family transcriptional regulator -
  V4Q90_RS11935 (V4Q90_11900) - 2681751..2681990 (+) 240 WP_011212823.1 hypothetical protein -
  V4Q90_RS11940 (V4Q90_11905) - 2682021..2682227 (+) 207 WP_011212824.1 hypothetical protein -
  V4Q90_RS11945 (V4Q90_11910) - 2682176..2683384 (+) 1209 WP_011212825.1 site-specific integrase -
  V4Q90_RS11950 (V4Q90_11915) - 2683611..2684435 (+) 825 WP_011212826.1 hypothetical protein -

Sequence


Protein


Download         Length: 269 a.a.        Molecular weight: 30583.73 Da        Isoelectric Point: 7.2561

>NTDB_id=945433 V4Q90_RS11910 WP_011212818.1 2677849..2678658(+) (comEC) [Legionella pneumophila strain LEG1116]
MKLQIFDVEHGACALLTCINGTRLMIDCGHNANSGWKPGSYLRSQGVTHLDMLAITNYDEDHVSGLPDLLEQVHVNWLWR
NPSVSATDIKNMKAKNGMGYGIESLVNILPTYKYTGWQPPEFSFVERRGFYAPYPTFVDTNNLSMAIHLNIAGINFLFSG
DLESGGWNTLLKDQSFRNVIANTDIFIAPHHGRESGIYPQIFEEYQCFPHYIIMSDKSHMYDTQKTLDYYSSKARGGFFR
GKHRRVLTTRKDGSITFNFNFLKGECLVA

Nucleotide


Download         Length: 810 bp        

>NTDB_id=945433 V4Q90_RS11910 WP_011212818.1 2677849..2678658(+) (comEC) [Legionella pneumophila strain LEG1116]
GTGAAATTACAAATTTTTGATGTAGAACATGGTGCATGCGCACTCTTAACATGCATTAATGGCACAAGACTAATGATTGA
CTGTGGACATAACGCTAATAGTGGCTGGAAACCAGGTTCTTACTTGCGCAGTCAAGGAGTAACCCATCTCGATATGTTAG
CCATAACTAATTACGATGAAGATCACGTGAGTGGATTACCTGATTTACTTGAGCAAGTACATGTTAATTGGTTATGGCGT
AATCCATCAGTTTCAGCAACAGATATAAAAAATATGAAAGCCAAAAATGGAATGGGATATGGGATTGAAAGTTTAGTAAA
TATTCTCCCGACATATAAATATACAGGATGGCAACCGCCTGAGTTTTCATTTGTTGAAAGACGGGGTTTTTATGCTCCTT
ACCCTACTTTTGTAGACACGAATAATCTAAGCATGGCCATTCATCTTAATATTGCAGGAATAAATTTTTTGTTTTCAGGC
GATTTAGAATCAGGAGGATGGAATACTCTGTTAAAAGATCAGAGCTTTCGGAATGTGATTGCGAACACAGATATTTTTAT
AGCACCCCATCATGGACGAGAAAGTGGGATTTATCCCCAAATTTTCGAAGAATATCAGTGTTTCCCTCACTATATTATAA
TGTCCGATAAAAGCCATATGTACGATACACAAAAAACTCTAGATTACTATTCTAGTAAAGCACGCGGTGGTTTTTTTAGG
GGGAAACATCGTCGAGTTTTAACGACAAGAAAGGATGGTTCAATAACCTTTAATTTTAATTTTTTAAAGGGGGAATGTCT
TGTAGCTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEC Legionella pneumophila str. Paris

100

100

1