Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFXAA_RS19240 Genome accession   NZ_CP170717
Coordinates   3910987..3911160 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JP5014     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3905987..3916160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAA_RS19190 (ACFXAA_19190) comGD 3906107..3906544 (+) 438 WP_395135502.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAA_RS19195 (ACFXAA_19195) comGE 3906528..3906842 (+) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAA_RS19200 (ACFXAA_19200) comGF 3906751..3907251 (+) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  ACFXAA_RS19205 (ACFXAA_19205) comGG 3907252..3907629 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAA_RS19210 (ACFXAA_19210) - 3907686..3907865 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAA_RS19215 (ACFXAA_19215) - 3907905..3908234 (-) 330 WP_060674607.1 DUF3889 domain-containing protein -
  ACFXAA_RS19220 (ACFXAA_19220) tapA 3908493..3909164 (+) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAA_RS19225 (ACFXAA_19225) sipW 3909136..3909720 (+) 585 WP_061860711.1 signal peptidase I SipW -
  ACFXAA_RS19230 (ACFXAA_19230) tasA 3909785..3910570 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAA_RS19235 (ACFXAA_19235) sinR 3910618..3910953 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAA_RS19240 (ACFXAA_19240) sinI 3910987..3911160 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFXAA_RS19245 (ACFXAA_19245) - 3911337..3912131 (-) 795 WP_061860710.1 YqhG family protein -
  ACFXAA_RS19250 (ACFXAA_19250) - 3912153..3913823 (-) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  ACFXAA_RS19255 (ACFXAA_19255) gcvT 3914247..3915347 (+) 1101 WP_163069075.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=945116 ACFXAA_RS19240 WP_003153105.1 3910987..3911160(-) (sinI) [Bacillus amyloliquefaciens strain JP5014]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=945116 ACFXAA_RS19240 WP_003153105.1 3910987..3911160(-) (sinI) [Bacillus amyloliquefaciens strain JP5014]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702