Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACFXAA_RS09355 Genome accession   NZ_CP170717
Coordinates   1941513..1941632 (-) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP5014     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1936513..1946632
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAA_RS09330 (ACFXAA_09330) - 1936756..1937514 (-) 759 WP_015416812.1 ABC transporter ATP-binding protein -
  ACFXAA_RS09335 (ACFXAA_09335) - 1937508..1938455 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACFXAA_RS09340 (ACFXAA_09340) ceuB 1938445..1939398 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACFXAA_RS09345 (ACFXAA_09345) - 1939812..1941176 (+) 1365 WP_033575080.1 aspartate kinase -
  ACFXAA_RS09350 (ACFXAA_09350) - 1941256..1941366 (+) 111 WP_370529518.1 YjcZ family sporulation protein -
  ACFXAA_RS09355 (ACFXAA_09355) phrC 1941513..1941632 (-) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACFXAA_RS09360 (ACFXAA_09360) rapC 1941616..1942764 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACFXAA_RS09365 (ACFXAA_09365) - 1942917..1944350 (-) 1434 WP_015416810.1 HAMP domain-containing sensor histidine kinase -
  ACFXAA_RS09370 (ACFXAA_09370) - 1944337..1945020 (-) 684 WP_014416901.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=945034 ACFXAA_RS09355 WP_033575081.1 1941513..1941632(-) (phrC) [Bacillus amyloliquefaciens strain JP5014]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=945034 ACFXAA_RS09355 WP_033575081.1 1941513..1941632(-) (phrC) [Bacillus amyloliquefaciens strain JP5014]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744