Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFW99_RS12200 | Genome accession | NZ_CP170651 |
| Coordinates | 2530740..2530913 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JP5025 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2525740..2535913
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFW99_RS12185 (ACFW99_12185) | gcvT | 2526553..2527653 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACFW99_RS12190 (ACFW99_12190) | - | 2528077..2529747 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| ACFW99_RS12195 (ACFW99_12195) | - | 2529769..2530563 (+) | 795 | WP_156240427.1 | YqhG family protein | - |
| ACFW99_RS12200 (ACFW99_12200) | sinI | 2530740..2530913 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACFW99_RS12205 (ACFW99_12205) | sinR | 2530947..2531282 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFW99_RS12210 (ACFW99_12210) | tasA | 2531330..2532115 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFW99_RS12215 (ACFW99_12215) | sipW | 2532180..2532764 (-) | 585 | WP_061860711.1 | signal peptidase I SipW | - |
| ACFW99_RS12220 (ACFW99_12220) | tapA | 2532736..2533407 (-) | 672 | WP_060674605.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFW99_RS12225 (ACFW99_12225) | - | 2533666..2533995 (+) | 330 | WP_060674607.1 | DUF3889 domain-containing protein | - |
| ACFW99_RS12230 (ACFW99_12230) | - | 2534035..2534214 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFW99_RS12235 (ACFW99_12235) | comGG | 2534271..2534648 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFW99_RS12240 (ACFW99_12240) | comGF | 2534649..2535149 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| ACFW99_RS12245 (ACFW99_12245) | comGE | 2535058..2535372 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACFW99_RS12250 (ACFW99_12250) | comGD | 2535356..2535793 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=944755 ACFW99_RS12200 WP_003153105.1 2530740..2530913(+) (sinI) [Bacillus amyloliquefaciens strain JP5025]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=944755 ACFW99_RS12200 WP_003153105.1 2530740..2530913(+) (sinI) [Bacillus amyloliquefaciens strain JP5025]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |