Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFW99_RS12200 Genome accession   NZ_CP170651
Coordinates   2530740..2530913 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JP5025     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2525740..2535913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFW99_RS12185 (ACFW99_12185) gcvT 2526553..2527653 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFW99_RS12190 (ACFW99_12190) - 2528077..2529747 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  ACFW99_RS12195 (ACFW99_12195) - 2529769..2530563 (+) 795 WP_156240427.1 YqhG family protein -
  ACFW99_RS12200 (ACFW99_12200) sinI 2530740..2530913 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFW99_RS12205 (ACFW99_12205) sinR 2530947..2531282 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFW99_RS12210 (ACFW99_12210) tasA 2531330..2532115 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFW99_RS12215 (ACFW99_12215) sipW 2532180..2532764 (-) 585 WP_061860711.1 signal peptidase I SipW -
  ACFW99_RS12220 (ACFW99_12220) tapA 2532736..2533407 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  ACFW99_RS12225 (ACFW99_12225) - 2533666..2533995 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  ACFW99_RS12230 (ACFW99_12230) - 2534035..2534214 (-) 180 WP_003153093.1 YqzE family protein -
  ACFW99_RS12235 (ACFW99_12235) comGG 2534271..2534648 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFW99_RS12240 (ACFW99_12240) comGF 2534649..2535149 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  ACFW99_RS12245 (ACFW99_12245) comGE 2535058..2535372 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFW99_RS12250 (ACFW99_12250) comGD 2535356..2535793 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=944755 ACFW99_RS12200 WP_003153105.1 2530740..2530913(+) (sinI) [Bacillus amyloliquefaciens strain JP5025]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=944755 ACFW99_RS12200 WP_003153105.1 2530740..2530913(+) (sinI) [Bacillus amyloliquefaciens strain JP5025]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702