Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V9W60_RS14950 Genome accession   NZ_CP146759
Coordinates   2885439..2885579 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain JJ61     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2880439..2890579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W60_RS14925 (V9W60_14925) - 2880705..2881094 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  V9W60_RS14930 (V9W60_14930) comA 2881118..2881759 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  V9W60_RS14935 (V9W60_14935) comP 2881840..2884152 (-) 2313 WP_058336868.1 ATP-binding protein Regulator
  V9W60_RS14940 (V9W60_14940) comX 2884206..2884376 (-) 171 WP_074041927.1 competence pheromone ComX -
  V9W60_RS14945 (V9W60_14945) - 2884373..2885287 (-) 915 WP_035701208.1 polyprenyl synthetase family protein -
  V9W60_RS14950 (V9W60_14950) degQ 2885439..2885579 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  V9W60_RS14955 (V9W60_14955) - 2886085..2886438 (+) 354 WP_338704229.1 inner spore coat protein -
  V9W60_RS14960 (V9W60_14960) - 2886475..2887701 (-) 1227 WP_035701209.1 HDOD domain-containing protein -
  V9W60_RS14965 (V9W60_14965) - 2887842..2889311 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  V9W60_RS14970 (V9W60_14970) - 2889329..2889880 (-) 552 WP_327854901.1 isochorismatase family cysteine hydrolase -
  V9W60_RS14975 (V9W60_14975) - 2889941..2890348 (-) 408 WP_024719733.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=944258 V9W60_RS14950 WP_003213123.1 2885439..2885579(-) (degQ) [Bacillus altitudinis strain JJ61]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=944258 V9W60_RS14950 WP_003213123.1 2885439..2885579(-) (degQ) [Bacillus altitudinis strain JJ61]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696