Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACEZ45_RS11955 Genome accession   NZ_CP169877
Coordinates   2471445..2471822 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JF     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2466445..2476822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEZ45_RS11915 (ACEZ45_11915) - 2466944..2467738 (+) 795 WP_069473503.1 YqhG family protein -
  ACEZ45_RS11920 (ACEZ45_11920) sinI 2467915..2468088 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACEZ45_RS11925 (ACEZ45_11925) sinR 2468122..2468457 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEZ45_RS11930 (ACEZ45_11930) tasA 2468505..2469290 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACEZ45_RS11935 (ACEZ45_11935) sipW 2469354..2469938 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACEZ45_RS11940 (ACEZ45_11940) tapA 2469910..2470581 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  ACEZ45_RS11945 (ACEZ45_11945) - 2470840..2471169 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACEZ45_RS11950 (ACEZ45_11950) - 2471209..2471388 (-) 180 WP_003153093.1 YqzE family protein -
  ACEZ45_RS11955 (ACEZ45_11955) comGG 2471445..2471822 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEZ45_RS11960 (ACEZ45_11960) comGF 2471823..2472218 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACEZ45_RS11965 (ACEZ45_11965) comGE 2472232..2472546 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACEZ45_RS11970 (ACEZ45_11970) comGD 2472530..2472967 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACEZ45_RS11975 (ACEZ45_11975) comGC 2472957..2473265 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACEZ45_RS11980 (ACEZ45_11980) comGB 2473270..2474307 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACEZ45_RS11985 (ACEZ45_11985) comGA 2474294..2475364 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACEZ45_RS11990 (ACEZ45_11990) - 2475556..2476506 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=942113 ACEZ45_RS11955 WP_003153092.1 2471445..2471822(-) (comGG) [Bacillus amyloliquefaciens strain JF]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=942113 ACEZ45_RS11955 WP_003153092.1 2471445..2471822(-) (comGG) [Bacillus amyloliquefaciens strain JF]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512