Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrR   Type   Regulator
Locus tag   V6U66_RS02070 Genome accession   NZ_CP145864
Coordinates   390972..391415 (+) Length   147 a.a.
NCBI ID   WP_002885568.1    Uniprot ID   A0A0A1DW04
Organism   Streptococcus salivarius strain KSS7     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 391706..440756 390972..391415 flank 291


Gene organization within MGE regions


Location: 390972..440756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U66_RS02070 (V6U66_02075) rcrR 390972..391415 (+) 444 WP_002885568.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  V6U66_RS02075 (V6U66_02080) rcrP 391419..393233 (+) 1815 WP_410534538.1 ABC transporter ATP-binding protein Regulator
  V6U66_RS02080 (V6U66_02085) rcrQ 393223..395001 (+) 1779 WP_049529161.1 ABC transporter ATP-binding protein Regulator
  V6U66_RS02085 (V6U66_02090) - 395109..395732 (+) 624 WP_002886697.1 GNAT family N-acetyltransferase -
  V6U66_RS02090 (V6U66_02095) - 395880..396503 (+) 624 WP_045769267.1 GTP pyrophosphokinase family protein -
  V6U66_RS02095 (V6U66_02100) - 396505..397182 (+) 678 WP_038675394.1 response regulator transcription factor -
  V6U66_RS02100 (V6U66_02105) - 397196..398419 (+) 1224 WP_045769266.1 sensor histidine kinase -
  V6U66_RS02105 (V6U66_02110) pyrH 398657..399394 (+) 738 WP_002885551.1 UMP kinase -
  V6U66_RS02110 (V6U66_02115) frr 399409..399966 (+) 558 WP_002886708.1 ribosome recycling factor -
  V6U66_RS02115 (V6U66_02120) cvfB 400056..400913 (+) 858 WP_002886710.1 RNA-binding virulence regulatory protein CvfB -
  V6U66_RS02120 (V6U66_02125) - 400922..401137 (+) 216 WP_002885591.1 YozE family protein -
  V6U66_RS02125 (V6U66_02130) - 401377..402636 (+) 1260 WP_002886711.1 LysM peptidoglycan-binding domain-containing protein -
  V6U66_RS02130 (V6U66_02135) - 402716..403780 (+) 1065 WP_002886712.1 PhoH family protein -
  V6U66_RS02135 (V6U66_02140) - 403905..404036 (+) 132 WP_002886713.1 hypothetical protein -
  V6U66_RS02140 (V6U66_02145) - 404037..404603 (+) 567 WP_080936865.1 hypothetical protein -
  V6U66_RS02145 (V6U66_02150) - 404756..405844 (+) 1089 WP_045772170.1 hypothetical protein -
  V6U66_RS02150 (V6U66_02155) - 405975..406853 (+) 879 WP_014633530.1 hypothetical protein -
  V6U66_RS02155 (V6U66_02160) metG 406963..408954 (+) 1992 WP_410534539.1 methionine--tRNA ligase -
  V6U66_RS02160 (V6U66_02165) - 409162..410007 (-) 846 WP_045772172.1 aldo/keto reductase -
  V6U66_RS02165 (V6U66_02170) - 410018..410914 (-) 897 WP_045772173.1 LysR family transcriptional regulator -
  V6U66_RS02170 (V6U66_02175) - 411154..411894 (-) 741 WP_002886723.1 CPBP family intramembrane glutamic endopeptidase -
  V6U66_RS02175 (V6U66_02180) - 412303..414261 (+) 1959 WP_002886728.1 GbpC/Spa domain-containing protein -
  V6U66_RS02180 (V6U66_02185) - 414490..415329 (+) 840 WP_002886729.1 CHAP domain-containing protein -
  V6U66_RS02185 (V6U66_02190) - 415899..416213 (+) 315 WP_000420681.1 YdcP family protein -
  V6U66_RS02190 (V6U66_02195) - 416229..416615 (+) 387 WP_000985040.1 YdcP family protein -
  V6U66_RS02195 (V6U66_02200) - 416655..418049 (+) 1395 WP_002368310.1 FtsK/SpoIIIE domain-containing protein -
  V6U66_RS02200 (V6U66_02205) - 418052..418207 (+) 156 WP_002390709.1 hypothetical protein -
  V6U66_RS02205 (V6U66_02210) mobT 418226..419430 (+) 1205 Protein_373 MobT family relaxase -
  V6U66_RS02210 (V6U66_02215) - 419473..419694 (+) 222 WP_001009056.1 hypothetical protein -
  V6U66_RS02215 (V6U66_02220) - 419811..420308 (+) 498 WP_002368312.1 antirestriction protein ArdA -
  V6U66_RS02220 (V6U66_02225) - 420322..420714 (+) 393 WP_025186755.1 conjugal transfer protein -
  V6U66_RS02225 (V6U66_02230) - 420698..423145 (+) 2448 WP_002368314.1 ATP-binding protein -
  V6U66_RS02230 (V6U66_02235) - 423148..425325 (+) 2178 Protein_378 CD3337/EF1877 family mobilome membrane protein -
  V6U66_RS02235 (V6U66_02240) - 425322..426323 (+) 1002 WP_014262668.1 lysozyme family protein -
  V6U66_RS02240 (V6U66_02245) - 426320..427252 (+) 933 WP_041250823.1 conjugal transfer protein -
  V6U66_RS02245 (V6U66_02250) - 427542..427613 (+) 72 WP_230373340.1 tetracycline resistance protein -
  V6U66_RS02250 (V6U66_02255) tet(M) 427629..429548 (+) 1920 WP_014262666.1 tetracycline resistance ribosomal protection protein Tet(M) -
  V6U66_RS02255 (V6U66_02260) - 429666..429833 (+) 168 WP_076640876.1 cysteine-rich KTR domain-containing protein -
  V6U66_RS02260 (V6U66_02265) - 429890..430243 (-) 354 WP_014262665.1 helix-turn-helix domain-containing protein -
  V6U66_RS02265 (V6U66_02270) - 430754..431179 (+) 426 WP_000804877.1 sigma-70 family RNA polymerase sigma factor -
  V6U66_RS02270 (V6U66_02275) - 431176..431406 (+) 231 WP_001224508.1 helix-turn-helix domain-containing protein -
  V6U66_RS02275 (V6U66_02280) - 431868..432071 (+) 204 WP_000814510.1 excisionase -
  V6U66_RS02280 (V6U66_02285) - 432153..433370 (+) 1218 WP_001291569.1 tyrosine-type recombinase/integrase -
  V6U66_RS02285 (V6U66_02290) - 433639..434629 (-) 991 Protein_389 IS3 family transposase -
  V6U66_RS02290 (V6U66_02295) - 435953..436912 (+) 960 WP_049529144.1 competence protein CoiA -
  V6U66_RS02295 (V6U66_02300) pepF 436923..438728 (+) 1806 WP_014633523.1 oligoendopeptidase F Regulator
  V6U66_RS02300 (V6U66_02305) - 438941..440161 (+) 1221 WP_049529141.1 OFA family MFS transporter -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 17181.67 Da        Isoelectric Point: 9.3639

>NTDB_id=940561 V6U66_RS02070 WP_002885568.1 390972..391415(+) (rcrR) [Streptococcus salivarius strain KSS7]
MHGKDTFSEFREFINTMESRVQELGKVHGVEHLAGPQGFAVKYLSDNQDKEIFIKDIEKRLCISKSVASNLVKRMEKNGF
VELVTSDKDKRYKYVHLTDLGKKKARDVKHFREAIHEQLLEGISKEDAETAFRVFHQIRMNLEKNKE

Nucleotide


Download         Length: 444 bp        

>NTDB_id=940561 V6U66_RS02070 WP_002885568.1 390972..391415(+) (rcrR) [Streptococcus salivarius strain KSS7]
ATGCATGGAAAAGATACTTTTAGTGAATTCAGAGAATTCATCAATACTATGGAATCTCGCGTGCAAGAGTTAGGAAAGGT
CCATGGGGTTGAGCATTTAGCTGGCCCGCAAGGATTTGCCGTCAAGTATTTGTCTGACAATCAAGATAAAGAAATCTTTA
TCAAAGACATTGAAAAAAGACTATGTATTTCTAAATCAGTGGCTAGTAATTTGGTCAAACGAATGGAAAAAAATGGTTTT
GTTGAGTTGGTGACATCGGACAAGGATAAACGCTACAAGTATGTTCATCTGACAGACTTAGGTAAAAAGAAAGCTCGAGA
TGTCAAACATTTTCGAGAGGCCATCCATGAACAGCTGTTAGAAGGTATTTCCAAAGAAGATGCTGAAACAGCTTTCCGTG
TCTTTCACCAAATTCGTATGAATTTAGAAAAAAATAAGGAGTAA

Domains


Predicted by InterproScan.

(37-91)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0A1DW04

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

58.156

95.918

0.558