Detailed information
Overview
| Name | rcrR | Type | Regulator |
| Locus tag | V6U66_RS02070 | Genome accession | NZ_CP145864 |
| Coordinates | 390972..391415 (+) | Length | 147 a.a. |
| NCBI ID | WP_002885568.1 | Uniprot ID | A0A0A1DW04 |
| Organism | Streptococcus salivarius strain KSS7 | ||
| Function | regulate competence (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 391706..440756 | 390972..391415 | flank | 291 |
Gene organization within MGE regions
Location: 390972..440756
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6U66_RS02070 (V6U66_02075) | rcrR | 390972..391415 (+) | 444 | WP_002885568.1 | MarR family winged helix-turn-helix transcriptional regulator | Regulator |
| V6U66_RS02075 (V6U66_02080) | rcrP | 391419..393233 (+) | 1815 | WP_410534538.1 | ABC transporter ATP-binding protein | Regulator |
| V6U66_RS02080 (V6U66_02085) | rcrQ | 393223..395001 (+) | 1779 | WP_049529161.1 | ABC transporter ATP-binding protein | Regulator |
| V6U66_RS02085 (V6U66_02090) | - | 395109..395732 (+) | 624 | WP_002886697.1 | GNAT family N-acetyltransferase | - |
| V6U66_RS02090 (V6U66_02095) | - | 395880..396503 (+) | 624 | WP_045769267.1 | GTP pyrophosphokinase family protein | - |
| V6U66_RS02095 (V6U66_02100) | - | 396505..397182 (+) | 678 | WP_038675394.1 | response regulator transcription factor | - |
| V6U66_RS02100 (V6U66_02105) | - | 397196..398419 (+) | 1224 | WP_045769266.1 | sensor histidine kinase | - |
| V6U66_RS02105 (V6U66_02110) | pyrH | 398657..399394 (+) | 738 | WP_002885551.1 | UMP kinase | - |
| V6U66_RS02110 (V6U66_02115) | frr | 399409..399966 (+) | 558 | WP_002886708.1 | ribosome recycling factor | - |
| V6U66_RS02115 (V6U66_02120) | cvfB | 400056..400913 (+) | 858 | WP_002886710.1 | RNA-binding virulence regulatory protein CvfB | - |
| V6U66_RS02120 (V6U66_02125) | - | 400922..401137 (+) | 216 | WP_002885591.1 | YozE family protein | - |
| V6U66_RS02125 (V6U66_02130) | - | 401377..402636 (+) | 1260 | WP_002886711.1 | LysM peptidoglycan-binding domain-containing protein | - |
| V6U66_RS02130 (V6U66_02135) | - | 402716..403780 (+) | 1065 | WP_002886712.1 | PhoH family protein | - |
| V6U66_RS02135 (V6U66_02140) | - | 403905..404036 (+) | 132 | WP_002886713.1 | hypothetical protein | - |
| V6U66_RS02140 (V6U66_02145) | - | 404037..404603 (+) | 567 | WP_080936865.1 | hypothetical protein | - |
| V6U66_RS02145 (V6U66_02150) | - | 404756..405844 (+) | 1089 | WP_045772170.1 | hypothetical protein | - |
| V6U66_RS02150 (V6U66_02155) | - | 405975..406853 (+) | 879 | WP_014633530.1 | hypothetical protein | - |
| V6U66_RS02155 (V6U66_02160) | metG | 406963..408954 (+) | 1992 | WP_410534539.1 | methionine--tRNA ligase | - |
| V6U66_RS02160 (V6U66_02165) | - | 409162..410007 (-) | 846 | WP_045772172.1 | aldo/keto reductase | - |
| V6U66_RS02165 (V6U66_02170) | - | 410018..410914 (-) | 897 | WP_045772173.1 | LysR family transcriptional regulator | - |
| V6U66_RS02170 (V6U66_02175) | - | 411154..411894 (-) | 741 | WP_002886723.1 | CPBP family intramembrane glutamic endopeptidase | - |
| V6U66_RS02175 (V6U66_02180) | - | 412303..414261 (+) | 1959 | WP_002886728.1 | GbpC/Spa domain-containing protein | - |
| V6U66_RS02180 (V6U66_02185) | - | 414490..415329 (+) | 840 | WP_002886729.1 | CHAP domain-containing protein | - |
| V6U66_RS02185 (V6U66_02190) | - | 415899..416213 (+) | 315 | WP_000420681.1 | YdcP family protein | - |
| V6U66_RS02190 (V6U66_02195) | - | 416229..416615 (+) | 387 | WP_000985040.1 | YdcP family protein | - |
| V6U66_RS02195 (V6U66_02200) | - | 416655..418049 (+) | 1395 | WP_002368310.1 | FtsK/SpoIIIE domain-containing protein | - |
| V6U66_RS02200 (V6U66_02205) | - | 418052..418207 (+) | 156 | WP_002390709.1 | hypothetical protein | - |
| V6U66_RS02205 (V6U66_02210) | mobT | 418226..419430 (+) | 1205 | Protein_373 | MobT family relaxase | - |
| V6U66_RS02210 (V6U66_02215) | - | 419473..419694 (+) | 222 | WP_001009056.1 | hypothetical protein | - |
| V6U66_RS02215 (V6U66_02220) | - | 419811..420308 (+) | 498 | WP_002368312.1 | antirestriction protein ArdA | - |
| V6U66_RS02220 (V6U66_02225) | - | 420322..420714 (+) | 393 | WP_025186755.1 | conjugal transfer protein | - |
| V6U66_RS02225 (V6U66_02230) | - | 420698..423145 (+) | 2448 | WP_002368314.1 | ATP-binding protein | - |
| V6U66_RS02230 (V6U66_02235) | - | 423148..425325 (+) | 2178 | Protein_378 | CD3337/EF1877 family mobilome membrane protein | - |
| V6U66_RS02235 (V6U66_02240) | - | 425322..426323 (+) | 1002 | WP_014262668.1 | lysozyme family protein | - |
| V6U66_RS02240 (V6U66_02245) | - | 426320..427252 (+) | 933 | WP_041250823.1 | conjugal transfer protein | - |
| V6U66_RS02245 (V6U66_02250) | - | 427542..427613 (+) | 72 | WP_230373340.1 | tetracycline resistance protein | - |
| V6U66_RS02250 (V6U66_02255) | tet(M) | 427629..429548 (+) | 1920 | WP_014262666.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| V6U66_RS02255 (V6U66_02260) | - | 429666..429833 (+) | 168 | WP_076640876.1 | cysteine-rich KTR domain-containing protein | - |
| V6U66_RS02260 (V6U66_02265) | - | 429890..430243 (-) | 354 | WP_014262665.1 | helix-turn-helix domain-containing protein | - |
| V6U66_RS02265 (V6U66_02270) | - | 430754..431179 (+) | 426 | WP_000804877.1 | sigma-70 family RNA polymerase sigma factor | - |
| V6U66_RS02270 (V6U66_02275) | - | 431176..431406 (+) | 231 | WP_001224508.1 | helix-turn-helix domain-containing protein | - |
| V6U66_RS02275 (V6U66_02280) | - | 431868..432071 (+) | 204 | WP_000814510.1 | excisionase | - |
| V6U66_RS02280 (V6U66_02285) | - | 432153..433370 (+) | 1218 | WP_001291569.1 | tyrosine-type recombinase/integrase | - |
| V6U66_RS02285 (V6U66_02290) | - | 433639..434629 (-) | 991 | Protein_389 | IS3 family transposase | - |
| V6U66_RS02290 (V6U66_02295) | - | 435953..436912 (+) | 960 | WP_049529144.1 | competence protein CoiA | - |
| V6U66_RS02295 (V6U66_02300) | pepF | 436923..438728 (+) | 1806 | WP_014633523.1 | oligoendopeptidase F | Regulator |
| V6U66_RS02300 (V6U66_02305) | - | 438941..440161 (+) | 1221 | WP_049529141.1 | OFA family MFS transporter | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 17181.67 Da Isoelectric Point: 9.3639
>NTDB_id=940561 V6U66_RS02070 WP_002885568.1 390972..391415(+) (rcrR) [Streptococcus salivarius strain KSS7]
MHGKDTFSEFREFINTMESRVQELGKVHGVEHLAGPQGFAVKYLSDNQDKEIFIKDIEKRLCISKSVASNLVKRMEKNGF
VELVTSDKDKRYKYVHLTDLGKKKARDVKHFREAIHEQLLEGISKEDAETAFRVFHQIRMNLEKNKE
MHGKDTFSEFREFINTMESRVQELGKVHGVEHLAGPQGFAVKYLSDNQDKEIFIKDIEKRLCISKSVASNLVKRMEKNGF
VELVTSDKDKRYKYVHLTDLGKKKARDVKHFREAIHEQLLEGISKEDAETAFRVFHQIRMNLEKNKE
Nucleotide
Download Length: 444 bp
>NTDB_id=940561 V6U66_RS02070 WP_002885568.1 390972..391415(+) (rcrR) [Streptococcus salivarius strain KSS7]
ATGCATGGAAAAGATACTTTTAGTGAATTCAGAGAATTCATCAATACTATGGAATCTCGCGTGCAAGAGTTAGGAAAGGT
CCATGGGGTTGAGCATTTAGCTGGCCCGCAAGGATTTGCCGTCAAGTATTTGTCTGACAATCAAGATAAAGAAATCTTTA
TCAAAGACATTGAAAAAAGACTATGTATTTCTAAATCAGTGGCTAGTAATTTGGTCAAACGAATGGAAAAAAATGGTTTT
GTTGAGTTGGTGACATCGGACAAGGATAAACGCTACAAGTATGTTCATCTGACAGACTTAGGTAAAAAGAAAGCTCGAGA
TGTCAAACATTTTCGAGAGGCCATCCATGAACAGCTGTTAGAAGGTATTTCCAAAGAAGATGCTGAAACAGCTTTCCGTG
TCTTTCACCAAATTCGTATGAATTTAGAAAAAAATAAGGAGTAA
ATGCATGGAAAAGATACTTTTAGTGAATTCAGAGAATTCATCAATACTATGGAATCTCGCGTGCAAGAGTTAGGAAAGGT
CCATGGGGTTGAGCATTTAGCTGGCCCGCAAGGATTTGCCGTCAAGTATTTGTCTGACAATCAAGATAAAGAAATCTTTA
TCAAAGACATTGAAAAAAGACTATGTATTTCTAAATCAGTGGCTAGTAATTTGGTCAAACGAATGGAAAAAAATGGTTTT
GTTGAGTTGGTGACATCGGACAAGGATAAACGCTACAAGTATGTTCATCTGACAGACTTAGGTAAAAAGAAAGCTCGAGA
TGTCAAACATTTTCGAGAGGCCATCCATGAACAGCTGTTAGAAGGTATTTCCAAAGAAGATGCTGAAACAGCTTTCCGTG
TCTTTCACCAAATTCGTATGAATTTAGAAAAAAATAAGGAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| rcrR | Streptococcus mutans UA159 |
58.156 |
95.918 |
0.558 |