Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V6Z34_RS15960 Genome accession   NZ_CP145817
Coordinates   3203120..3203260 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain WH-7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3198120..3208260
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6Z34_RS15935 - 3198460..3198843 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  V6Z34_RS15940 comA 3198865..3199509 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V6Z34_RS15945 comP 3199590..3201881 (-) 2292 WP_015387784.1 histidine kinase Regulator
  V6Z34_RS15950 comX 3201893..3202057 (-) 165 WP_007613432.1 competence pheromone ComX -
  V6Z34_RS15955 - 3202057..3202968 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  V6Z34_RS15960 degQ 3203120..3203260 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V6Z34_RS15965 - 3203726..3204067 (+) 342 WP_014305721.1 hypothetical protein -
  V6Z34_RS15970 - 3204074..3205294 (-) 1221 WP_063174635.1 EAL and HDOD domain-containing protein -
  V6Z34_RS15975 - 3205424..3206889 (-) 1466 Protein_3082 nicotinate phosphoribosyltransferase -
  V6Z34_RS15980 - 3206907..3207458 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  V6Z34_RS15985 - 3207555..3207953 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=940123 V6Z34_RS15960 WP_003152043.1 3203120..3203260(-) (degQ) [Bacillus velezensis strain WH-7]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=940123 V6Z34_RS15960 WP_003152043.1 3203120..3203260(-) (degQ) [Bacillus velezensis strain WH-7]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891