Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V6D45_RS15875 Genome accession   NZ_CP145722
Coordinates   3114018..3114158 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain kcgeb_S11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3109018..3119158
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6D45_RS15850 (V6D45_15855) - 3109336..3109716 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  V6D45_RS15855 (V6D45_15860) comA 3109733..3110377 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  V6D45_RS15860 (V6D45_15865) comP 3110458..3112764 (-) 2307 WP_268392280.1 two-component system sensor histidine kinase ComP Regulator
  V6D45_RS15865 (V6D45_15870) comX 3112779..3112952 (-) 174 WP_268392278.1 competence pheromone ComX -
  V6D45_RS15870 (V6D45_15875) comQ 3112967..3113833 (-) 867 WP_268392274.1 polyprenyl synthetase family protein Regulator
  V6D45_RS15875 (V6D45_15880) degQ 3114018..3114158 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  V6D45_RS15880 (V6D45_15885) - 3114380..3114505 (+) 126 WP_014114985.1 hypothetical protein -
  V6D45_RS15885 (V6D45_15890) - 3114620..3114988 (+) 369 WP_268454380.1 hypothetical protein -
  V6D45_RS15890 (V6D45_15895) pdeH 3114964..3116193 (-) 1230 WP_338443149.1 cyclic di-GMP phosphodiesterase -
  V6D45_RS15895 (V6D45_15900) - 3116329..3117801 (-) 1473 WP_268454377.1 nicotinate phosphoribosyltransferase -
  V6D45_RS15900 (V6D45_15905) - 3117817..3118368 (-) 552 WP_087987471.1 isochorismatase family cysteine hydrolase -
  V6D45_RS15905 (V6D45_15910) - 3118465..3118863 (-) 399 WP_268392264.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=939704 V6D45_RS15875 WP_003220708.1 3114018..3114158(-) (degQ) [Bacillus spizizenii strain kcgeb_S11]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=939704 V6D45_RS15875 WP_003220708.1 3114018..3114158(-) (degQ) [Bacillus spizizenii strain kcgeb_S11]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1